KEGG   Chlorocebus sabaeus (green monkey): 103219211
Entry
103219211         CDS       T04361                                 

Gene name
MSMP
Definition
(RefSeq) microseminoprotein, prostate associated
Organism
csab  Chlorocebus sabaeus (green monkey)
SSDB
Motif
Pfam: PSP94 VWC TILa
Other DBs
NCBI-GeneID: 103219211
NCBI-ProteinID: XP_007966970
Ensembl: ENSCSAG00000010584
UniProt: A0A0D9RDX2
Position
12
AA seq 139 aa
MALRMLWAGQAKGILGGWGIVCLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWL
RKDCFHCTCLHPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPD
PEWGSANTPVPGAPAPHSS
NT seq 420 nt   +upstreamnt  +downstreamnt
atggccctgaggatgctctgggctggacaggccaaggggatcctaggaggctgggggatc
gtctgcttggtgatgtctctactcctccagcacccaggagtctacagcaagtgctacttc
caagctcaagctccctgtcactatgaggggaaatatttcaccctgggtgagtcttggctc
cgcaaggactgtttccattgcacctgtctgcatcctgttggtgtgggctgctgtgacacg
tcccagcatcccatcgactttccggctgggtgtgaggtacgtcaggaggcaggaacctgc
cagttctccttggtgcaaaaatctgaccctcggctgccctgcaaagggggagggcctgac
ccagaatggggctcagccaacacccctgttcctggggctcctgctccccactccagctaa

DBGET integrated database retrieval system