KEGG   Chlorocebus sabaeus (green monkey): 103221355Help
Entry
103221355         CDS       T04361                                 

Gene name
GSTA5
Definition
(RefSeq) glutathione S-transferase alpha 5
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00480  Glutathione metabolism
csab00980  Metabolism of xenobiotics by cytochrome P450
csab00982  Drug metabolism - cytochrome P450
csab00983  Drug metabolism - other enzymes
csab01100  Metabolic pathways
csab01524  Platinum drug resistance
csab05200  Pathways in cancer
csab05204  Chemical carcinogenesis
csab05225  Hepatocellular carcinoma
csab05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103221355 (GSTA5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103221355 (GSTA5)
   00982 Drug metabolism - cytochrome P450
    103221355 (GSTA5)
   00983 Drug metabolism - other enzymes
    103221355 (GSTA5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103221355 (GSTA5)
   05204 Chemical carcinogenesis
    103221355 (GSTA5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103221355 (GSTA5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103221355 (GSTA5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103221355 (GSTA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:csab02000]
    103221355 (GSTA5)
Enzymes [BR:csab01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103221355 (GSTA5)
Transporters [BR:csab02000]
 Other transporters
  Pores ion channels [TC:1]
   103221355 (GSTA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_N GST_C GST_N_3
Motif
Other DBs
NCBI-GeneID: 103221355
NCBI-ProteinID: XP_007970443
Position
17
AA seq 222 aa AA seqDB search
MAEKPKLHYLNARGRMESTRWLLAAAGVEFEEKFLESAEDLDKLRNDGSLLFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGIVDLTEMVFLLITCQPEERDAK
TALVKEKIQNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDVKSLEEVRKIFRL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacccaagctccactacctcaatgcacggggcagaatggagtccacccgg
tggctcctggctgcagctggagtagagtttgaagagaaatttctagaatctgcagaagat
ttggacaagttaagaaatgatgggagtttgctgttccagcaagtaccaatggttgagatc
gacgggatgaagctggtgcagaccagagccattctcaactacattgccagcaaatacaac
ctctacgggaaagacataaaggagagagccctgattgatatgtatacagaaggtatagta
gatttgactgaaatggtctttcttctgatcacatgtcaacctgaggaaagagatgccaag
actgccttggtcaaagagaaaattcaaaaccgctatttccctgcctttgaaaaagtctta
aagagccatggacaagactaccttgttggcaacaagctgagccgggctgacattcacctg
gtggaacttctctactacgtggaagagcttgactccagccttatctccagcttccctctg
ctgaaggccctgaaaaccagaatcagcaacctgcccacggtgaagaagtttctgcaacct
ggcagccccaggaagcctcccatggatgtgaaaagtttagaagaagtaaggaagattttc
aggttgtaa

DBGET integrated database retrieval system