KEGG   Chlorocebus sabaeus (green monkey): 103223347Help
Entry
103223347         CDS       T04361                                 

Gene name
CACNA1I
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04010  MAPK signaling pathway
csab04020  Calcium signaling pathway
csab04713  Circadian entrainment
csab04925  Aldosterone synthesis and secretion
csab04927  Cortisol synthesis and secretion
csab04929  GnRH secretion
csab04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103223347 (CACNA1I)
   04020 Calcium signaling pathway
    103223347 (CACNA1I)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    103223347 (CACNA1I)
   04925 Aldosterone synthesis and secretion
    103223347 (CACNA1I)
   04927 Cortisol synthesis and secretion
    103223347 (CACNA1I)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103223347 (CACNA1I)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103223347 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:csab04040]
    103223347 (CACNA1I)
Ion channels [BR:csab04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103223347 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 103223347
NCBI-ProteinID: XP_007974034
Ensembl: ENSCSAG00000006219
Position
19
AA seq 2231 aa AA seqDB search
MPVSWRVGFSLHWGIYLFISGDRSSPPARTRQGSQLNVDMAESASPPSSAAAPAAEPGVT
TEQPGPQSPPSSPPGLEEPLDGADPHVPHPDLAPVAFFCLRQTTSPRNWCIKMVCNPWFE
CVSMLVILLNCVTLGMYQPCDDMDCLSDRCKILQVFDDFIFIFFAMEMVLKMVALGIFGK
KCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLL
LDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFLEENFTIQGDVALPPYYQPEED
DEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVYDFGAGRQDLNTSGLCVNWNRY
YNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLI
IVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYLSSSTVASYAEPGDCYEEIFQYV
CHILRKAKRRALGLYQALQSRRQALGPEAPAPAKPGPHAKEPRHYKLCPRHSPLDATPHT
LVQPIPATLASDPASCPCCQHEASRRPSGLGSTDSGQEGSGSGSSAGGEDEADGDGTRSS
EDGASSELGKEEEEEEEQADGAVWLCGDVWRETRAKLRGIVDSKYFNRGIMMAILVNTVS
MGIEHHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISI
WEIVGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIF
SILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSP
WASLYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDDDQSSSNMEEFDKLQEGLD
SSGDPKLFPIPMTPNGHLDPSLPLGGHLGPAGAAGPAPRLSLQPDPMLVALGSRKSSVMS
LGRMSYDQRSLSSSRSSYYGPWGRSGAWASRRSSWNSLKHKPPSAEHESLLSAERGGGAR
VCEVTGEEGLPRPAPLHAPHALHAHHAHHGPHLAHRHRHHRRTLSLDTRDSVDLAELVPT
VGAHPRAAWRAAGPAPGHEDCNGRMPSIAKDVFTKMGDRRDRGEDEEEIDYTLCFRVRKM
IDVYKPDWCEVREDWSVYLFSPENRFRVLCQTIIAHKLFDYVVLAFIFLNCITIALERPQ
IEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWNVLDGFLVFVSII
DIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLIC
CAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCMAANYRWVHHKYNFDNLGQALMSL
FVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVEN
FHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCHTRLLIHSMCTSHYLDIFI
TFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLVAFGLRRFFKDRWNQ
LDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVV
QALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQ
VSTGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHL
DDSNKEAQEDAEMDAELELEMAHGLGPGPRLPAGSPGAPGRGPGGAGGGGDAEGGLCRRC
YSPAQENLWLDSVSLIIKDSLEGELTIIDNLSGSIFHHYSSPAGCKKCHHDKQEVQLAET
EAFSLNSDRSSSILLGDDLSLEDPTACPPGPKDSKGELDPPEPMCVRDLDECFFPLSSTA
VSPGPENFLCEMEEIPFNPVQSWLKHESSQAAPPSPFSPDASSPLLPMPAEFFHPAVSAS
QKGPEKGTGAGTLPKIALQGSWASLRSPRVNCTLLRQATGSDTSLDASPSSSAGSLQTTL
EDSLTLSDSPRRALGPPAPAPGPRAGLSPAAHRRLSLRGRGLFSLRGLRAHQRSHSSGGS
TSPGCTYHDSMDPSDEEGRGGAGGGGAGSEHSETLSSLSLTSLFCPPPPPPLPGLTPARK
FSSTSSLAAPGRPRAAAPAHGLARSPSWAADRSKDPLGGAPLPMGLGPLAPPPQPLPGEL
EPGDAASKRKR
NT seq 6696 nt NT seq  +upstreamnt  +downstreamnt
atgccagtttcttggcgcgttggcttctctcttcactggggcatttatttatttatttct
ggggaccgatcctccccacccgcgcgtacccgtcagggctcccagctcaacgtggacatg
gctgagagcgcctccccgccctcatctgcagcagccccggctgccgagccgggagtcacc
acggagcagcccgggccccagagccccccatcctccccaccaggcctggaggagcccctg
gatggagctgatcctcatgtcccacacccagacctggcgcctgttgccttcttctgcctg
cgacagaccaccagcccccggaactggtgtatcaagatggtgtgcaacccgtggtttgaa
tgtgtcagcatgctggtgatcctgctgaactgcgtgacacttggcatgtaccagccgtgc
gacgacatggactgcctgtctgaccgctgcaagatcctgcaggtctttgatgacttcatc
tttatcttctttgccatggagatggtgctcaagatggtggccctggggatttttggcaag
aagtgctacctcggggacacatggaaccgcctggatttcttcatcgtcatggcagggatg
gtcgagtactccctggaccttcagaacatcaacctgtcggccatccgcactgtacgcgtc
ctgaggcccctcaaagccatcaaccgcgtgcccagtatgcggatcctggtgaacctgctc
ctggacacgctgcccatgctggggaatgtcctgctgctctgcttctttgtcttcttcatc
tttggcatcataggcgtgcagctctgggccggcctgctgcgcaaccgctgcttcctggag
gagaatttcaccatacaaggggatgtggccttgcccccatactaccagccggaggaggac
gatgagatgcccttcatctgctccctgtcgggggacaatgggatcatgggctgccatgag
atccccccactcaaggagcagggccgtgagtgctgcctgtccaaggatgacgtctatgac
tttggggcggggcgccaggacctcaacaccagcggcctctgtgtcaactggaaccgttac
tacaatgtgtgccgcacgggcagcgccaacccccacaagggtgccatcaactttgacaac
atcggttacgcttggattgtcatcttccaggtgatcactctggaaggctgggtggagatc
atgtactatgtgatggatgctcactccttctacaacttcatctacttcatcctgcttatc
atagtgggctccttcttcatgatcaacctgtgcctcgttgtcatagcgacccagttctcg
gagaccaagcagcgggagcaccggctgatgctggagcagcggcagcgctacctgtcctcc
agtacggtggccagctacgccgagcctggcgactgctacgaggagatcttccagtacgtc
tgccacatcctgcgcaaggccaagcgccgcgccctgggcctctaccaggccctgcagagc
cggcgccaggctctgggcccagaggccccagcgcccgccaaacctgggccccatgccaag
gagccccggcactacaagctgtgcccgcgacatagccccctggacgcgacgcctcacacc
ctggtgcagcccatccctgccacgctggcctctgaccccgccagctgcccttgctgccaa
catgaggccagccggcggccctcgggcctgggcagcaccgactcgggccaggagggctcg
ggctccgggagctccgctggtggcgaggacgaggcagatggggacgggacccggagcagc
gaggatggagcctcctcggaactggggaaggaggaggaggaggaggaggagcaggcggat
ggggcagtctggctgtgcggggacgtgtggcgggagacgcgagccaagctgcgcggcata
gtggacagcaagtacttcaaccggggcatcatgatggccatcctggtcaacaccgtcagc
atgggcatcgagcaccatgagcagccagaggagctgaccaacatcctggagatctgcaac
gtggtcttcaccagcatgtttgccctggagatgatcctgaagctggctgcatttgggctc
ttcgactacctgcgtaacccctacaacatcttcgatagcatcattgtcatcatcagcatc
tgggagatagtggggcaggcggatggtgggctgtcggtgctgcggaccttccggctgctg
cgcgtgctgaagctggtgcgcttcatgcctgccctgcggcgccagctcgtggtgctcatg
aagaccatggataacgtggccaccttctgcatgctgctcatgcttttcatcttcatcttc
agcattcttgggatgcacatttttggctgcaagttcagcctccgcacggacactggagac
acggtccctgacaggaagaacttcgactccctgctgtgggccatcgtcaccgtgttccag
atcctcacccaggaggactggaacgtcgtgctctacaacggcatggcctccacctccccc
tgggcctccctctactttgtcgccctcatgaccttcggcaactatgtgctcttcaacctg
ctggtggccatcctggtggagggcttccaggcggagggtgacgccaatcgctcctactcg
gacgacgaccagagctcatccaacatggaggaatttgacaagctccaggaaggcctagac
agcagcggagatcccaagctctttccaatccccatgacccccaatgggcacctggacccc
agtctcccgctgggtgggcacctaggtcctgctggggctgcgggacctgccccccgactc
tcactgcagccggaccctatgctggtggccctgggctcccgaaagagcagcgtcatgtct
ctggggaggatgagctatgatcagcgctccctgtccagctcccggagctcctactacggg
ccgtggggccgcagcggggcctgggccagccgccgctccagctggaacagcctcaagcac
aagccgccgtcggccgagcacgagtccctgctctccgcggagcgcggcggcggcgcccgg
gtctgcgaggttaccggggaggaggggctgccacggcccgcacccctgcacgccccgcac
gccctgcacgcccaccacgctcatcacgggccccatctggcacaccgccaccgccaccac
cgccggacactgtccctcgacaccagagactcggtggacctggccgagctggtgcccacc
gtgggcgcccacccccgggccgcttggagggcggcgggcccggcccccgggcatgaggac
tgcaatggcaggatgcccagcatcgccaaggacgtcttcaccaagatgggcgaccgccgg
gatcgcggggaggatgaggaggagatcgactacaccctgtgcttccgcgtccgcaagatg
atcgacgtctataagcctgactggtgcgaggtccgcgaagactggtctgtctacctcttc
tctcccgagaacaggttccgggtcctgtgtcagaccattattgcccacaagctcttcgac
tatgtcgtcctggccttcatctttctcaactgcatcaccattgccctggagcggcctcag
atcgaggctggcagcactgaacgcatctttctcaccgtgtccaactacatctttacggcc
atcttcgtgggcgagatgacactgaaggtggtctcgctgggcctgtacttcggcgagcag
gcatacctgcgcagcagctggaacgtgctggacggctttcttgtcttcgtgtccatcatc
gacatcgtggtgtccctggcctcggccgggggagccaaaatcctgggggtcctccgagtc
ttgcggctcctgcgcaccctacgtcccctgcgtgtcatcagccgggcaccgggcctgaag
ctggtggtggagacactcatctcctccctcaagcccatcgggaacatcgtgctcatctgc
tgtgccttcttcatcatctttggcatcctaggagttcagctcttcaagggcaagttctac
cactgtctgggcgtggacacccgcaacatcaccaaccgctcggactgcatggccgccaac
taccgctgggtccatcacaaatacaacttcgacaacctgggccaggctctgatgtccctc
tttgtcctggcatccaaggatggttgggtgaacatcatgtacaatggactggatgctgtc
gctgtggaccagcagcctgtgaccaaccacaacccctggatgctgctgtacttcatctcc
ttcctgctcatcgtcagcttcttcgtgctcaacatgtttgtgggtgtcgtggtggagaac
ttccacaagtgccggcagcaccaggaggctgaagaggcgcggcggcgggaggagaagcgg
ctgcggcgcctggagaagaagcgccggaaggcccagcggctgccctactatgccacctat
tgtcacacccgactgctcatccactccatgtgcaccagccactacctggacatcttcatc
accttcatcatctgcctcaacgtggtcaccatgtccctggagcactacaatcagcccacg
tccctggagacagccctcaagtactgcaactatatgttcaccactgtgtttgtgctggag
gctgtactgaagctggtggcatttggtctgaggcgcttcttcaaggaccgatggaaccag
ctggacctggccattgtgctactgtcagtcatgggcatcacactggaggagatagagatt
aatgcggccctgcccatcaaccccaccatcatccgcatcatgagggttctgcgcatcgcc
cgagtgctgaagctgttgaagatggccacagggatgcgggccctgctggacacggtggtg
caagctttgccccaggtgggcaacctgggcctcctcttcatgctgctcttcttcatctat
gctgcccttggggtggagctcttcgggaagctggtctgcaacgatgagaacccatgcgag
ggcatgagccgacatgccaccttcgagaacttcggcatggccttcctcacgctcttccag
gtctccacgggtgacaactggaacgggatcatgaaggacacgctgcgggactgcacccat
gatgagcgcagctgcctgagcagcctgcagtttgtgtcaccgctgtacttcgtgagcttc
gtgctcaccgcgcagttcgtgctcatcaacgtggtggtggctgtgctcatgaagcacctg
gacgacagcaataaggaggcgcaggaggacgccgagatggatgccgagctcgagctggag
atggcccatggcctgggccccggcccgaggctgcctgccggctccccgggcgcccctggc
cgagggccgggaggggcgggcggcgggggcgacgccgagggcggcttgtgccggcgctgc
tactcgcctgcccaggagaacctgtggctggacagcgtctctttaatcatcaaggactcc
ttggagggggagctgaccatcatcgacaacctctcgggctccatattccaccactactcc
tcgcccgccggctgcaagaaatgtcaccacgacaagcaagaggtgcagctggccgagacg
gaggccttctccctgaactcagacaggtcctcgtccatcctgctgggtgacgacctgagc
cttgaggaccccacagcctgcccccctggccccaaagacagcaagggtgagctggaccca
cctgagcccatgtgtgtgagagacctggacgaatgcttcttccccttgtcctctacggct
gtctcaccgggtccagagaacttcctgtgtgagatggaggagatcccattcaaccctgtc
cagtcctggctgaaacatgagagcagtcaagcagcacccccaagtcccttctccccggac
gcctccagccctctcctgcccatgccagccgagttcttccaccctgcagtgtctgccagc
cagaaaggcccagaaaagggcaccggcgctgggaccctccccaagattgcgctgcagggc
tcctgggcatctctgcggtcaccaagggtcaactgtaccctcctccggcaggccaccggg
agcgacacgtcgctggacgccagccccagcagctccgcgggcagcctgcagaccacgctg
gaggacagcctgaccctgagcgacagcccccggcgcgccctggggccgcccgcgcctgct
ccgggaccccgggccggcctgtcccccgccgcgcaccgccgcctgagcctgcggggccgg
ggcctgttcagcctgcgggggctgcgggcgcatcagcgcagccacagcagcgggggctcc
accagcccgggctgcacctaccacgactccatggacccctcggacgaggagggccgcggc
ggcgcgggcggcgggggcgcgggcagcgagcactcggagaccctcagcagcctctcgctc
acttccctcttctgcccgccgcccccgccgccgctccccggcctcacgcccgccaggaag
ttcagcagcaccagcagcctggccgcccccggccgcccccgcgccgccgccccggcccac
ggcctggcccggagcccctcgtgggccgcggaccgcagcaaggaccccctgggcggggca
ccgctgcccatgggcctgggccccttggcgcccccgccgcaaccgctccccggagagctg
gagccgggagacgccgccagcaagaggaagagatga

DBGET integrated database retrieval system