KEGG   Chlorocebus sabaeus (green monkey): 103223399Help
Entry
103223399         CDS       T04361                                 

Gene name
TNFRSF13C
Definition
(RefSeq) TNF receptor superfamily member 13C
  KO
K05151  tumor necrosis factor receptor superfamily member 13C
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04060  Cytokine-cytokine receptor interaction
csab04064  NF-kappa B signaling pathway
csab04672  Intestinal immune network for IgA production
csab05166  Human T-cell leukemia virus 1 infection
csab05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103223399 (TNFRSF13C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103223399 (TNFRSF13C)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    103223399 (TNFRSF13C)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    103223399 (TNFRSF13C)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103223399 (TNFRSF13C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:csab04050]
    103223399 (TNFRSF13C)
   04090 CD molecules [BR:csab04090]
    103223399 (TNFRSF13C)
Cytokine receptors [BR:csab04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   103223399 (TNFRSF13C)
CD molecules [BR:csab04090]
 Proteins
  103223399 (TNFRSF13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BaffR-Tall_bind BatA DUF4381 DUF4079 SKG6
Motif
Other DBs
NCBI-GeneID: 103223399
NCBI-ProteinID: XP_007974121
Position
19
AA seq 185 aa AA seqDB search
MKRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAAPASSPAPRTALQP
QESVGAGAGEAALSLPGLLFGAPALLGLALVLALVLVGLASWRRRQRRLRGASFAEAPDG
DKDKDEPLDKVIILSPGISDAAAPTWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTA
GPEQQ
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgagggccccggagcctgcggggcagggacgcgccagcccccacgccctgcgtc
ccggccgagtgcttcgacctgctggtccgccactgcgtggcctgcgggctcctgcgcacg
ccgcggcccaaaccggcagccccggccagcagccctgcgcccaggacggcgctgcagccg
caggagtcggtgggcgcgggggccggcgaggcggcgctgtccctacccgggctgctcttc
ggcgcccccgcgctgctgggcctggcactggtcctggcgctggtcctggtgggcctggcg
agctggaggcggcgccagcggcggcttcgcggcgcgtccttcgcagaggcccccgacgga
gacaaggacaaggacgagcccctggacaaggtcatcattctgtctccgggaatctctgat
gccgcagctcctacctggcctcctcctggggaagacccaggaaccaccccacctggccac
agtgtccctgtgccagccacagagctgggctccactgaactggtgaccaccaagacggct
ggccctgagcaacaataa

DBGET integrated database retrieval system