KEGG   Chlorocebus sabaeus (green monkey): 103223426Help
Entry
103223426         CDS       T04361                                 

Gene name
A4GALT
Definition
(RefSeq) alpha 1,4-galactosyltransferase
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00601  Glycosphingolipid biosynthesis - lacto and neolacto series
csab00603  Glycosphingolipid biosynthesis - globo and isoglobo series
csab01100  Metabolic pathways
Module
csab_M00068  Glycosphingolipid biosynthesis, globo-series, LacCer => Gb4Cer
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    103223426 (A4GALT)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    103223426 (A4GALT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:csab01003]
    103223426 (A4GALT)
Enzymes [BR:csab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     103223426 (A4GALT)
Glycosyltransferases [BR:csab01003]
 Glycan extension
  P blood group
   103223426 (A4GALT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug
Motif
Other DBs
NCBI-GeneID: 103223426
NCBI-ProteinID: XP_007974178
Ensembl: ENSCSAG00000019285
UniProt: A0A0D9SD56
Position
19
AA seq 353 aa AA seqDB search
MSKPPDLLLRLLRGAPRQRVCTLFIIGFKFTFFVSIMIYWHVVGEPKEQGQLYNLPADIP
CPTLAPPALPSHGPAPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGG
NASLPRHLGISLLSCFPNVHMLPLDLQELFRDTPLAGWYAAVQGRWEPYLFPVLSDASRI
ALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHEFMALCMRDFVDH
YNGWIWGHQGPQLLTRVFKKWCSIRSLAESHACRGVTTLPPEAFYPIPWQDWKKYFEDIN
PKELPQLLNATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHKAMKMYL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagccccccgacctcctgctgcggctgctccggggcgccccaaggcagcgggtc
tgcaccctgttcatcatcggcttcaagttcacgtttttcgtctccatcatgatctactgg
catgttgtgggagagcccaaggagcaagggcagctctataacctgccagcagatattccc
tgccccaccttggcaccccccgccctaccctcccacggccccgctccgggcaacatcttc
ttcctggagacttcagatcggaccaaccccaacttcctgttcatgtgctccgtggagtcg
gccgccagaactcaccccgaatcccacgtgctggtcctgatgaaagggcttccaggtggc
aacgcctccctgccccggcacctgggcatctcacttctgagctgcttcccgaatgtccac
atgctcccgctggacctgcaggaactgttccgggacacacccctggccggctggtacgcg
gctgtgcaggggcgctgggaaccgtacctgttccccgtgctctccgacgcctccaggatc
gcactcatgtggaagttcggcggcatctacctggacaccgacttcattgttctcaagaac
ctgaggaacctgaccaacgtgctgggcacccagtcccgctacgtcctcaacggcgccttc
ctggccttcgagcgcaggcacgagttcatggcgctgtgcatgcgggacttcgtggaccac
tacaacggctggatctggggtcaccagggcccgcagctgctcacacgggtcttcaagaag
tggtgctccatccgcagcctggccgagagccacgcctgccgtggcgtcaccaccctgccc
cccgaggccttctaccccatcccgtggcaggactggaagaagtactttgaggacatcaac
cccaaggagctgccacagctgctcaatgccacctatgctgtccacgtgtggaacaagaag
agccagggcacgcggttcgaggccacgtccagggcactgctcgcccagctccatgcccgc
tactgccccacgacacacaaggccatgaagatgtacttgtga

DBGET integrated database retrieval system