KEGG   Chlorocebus sabaeus (green monkey): 103223575Help
Entry
103223575         CDS       T04361                                 

Gene name
CPT1B
Definition
(RefSeq) carnitine palmitoyltransferase 1B
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00071  Fatty acid degradation
csab01212  Fatty acid metabolism
csab03320  PPAR signaling pathway
csab04152  AMPK signaling pathway
csab04714  Thermogenesis
csab04920  Adipocytokine signaling pathway
csab04922  Glucagon signaling pathway
csab04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103223575 (CPT1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    103223575 (CPT1B)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103223575 (CPT1B)
   04920 Adipocytokine signaling pathway
    103223575 (CPT1B)
   03320 PPAR signaling pathway
    103223575 (CPT1B)
  09159 Environmental adaptation
   04714 Thermogenesis
    103223575 (CPT1B)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103223575 (CPT1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:csab03029]
    103223575 (CPT1B)
Enzymes [BR:csab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     103223575 (CPT1B)
Mitochondrial biogenesis [BR:csab03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    103223575 (CPT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Motif
Other DBs
NCBI-GeneID: 103223575
NCBI-ProteinID: XP_007974465
Ensembl: ENSCSAG00000004797
UniProt: A0A0D9QXN4
Position
19
AA seq 772 aa AA seqDB search
MAEAHQAVAFQFTVTPEGVDFRLSREALKHVYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVVMATVGSSFCNVDVSLGLVGCIQRCLPQGCGPYQTPQTRALLSMAIFSTGIWVTG
IFFFRQTLKLLLSYHGWMFEMHGKTSNLTRIWAMCVRLLSSRHPMLYSFQTSLPKLPVPR
VSATIQRYLESVRPLLDDEEYYRMEMLAKEFQNKTAPRLQKYLVLKSWWASNYVSDWWEE
YIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARLGNTIHAMIMYRRKLDREEIKPVMALG
IVPMCSYQMERMFNTTRVPGKETDVLQHLSDSRHVAVYHKGRFFKLWLYEGSRLLKPQDL
EMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVA
LDEESYRYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPI
IGHLWEFVLGTDSFHLGYTETGHCLGKPNPALPPPTRLQWDIPKQCQAVIESSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREG
RTETVRSCTSESTAFVQAMVERSHAKADLRDLFQKAAKKHQNMYRLAMTGAGIDRHLFCL
YLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQIRMFDPEQHPNHLGAGGGFGPVADDGY
GVSYMIAGENTIFFHISSKFSSSETNAQRFGNHIRQALLDLADLFQVPKTDS
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcgcaccaggccgtggccttccagttcacggtgaccccagagggggtcgac
ttccggctcagtcgggaggccctgaaacacgtctacctgtctgggatcaactcctggaag
aaacgcctgatccgcatcaagaatggcatcctcaggggtgtgtaccctggcagccccacc
agctggctggtcgtcgtcatggcaacagtgggttcctccttctgcaacgtggacgtctcc
ttggggctggtcggttgcatccagagatgcctccctcaggggtgtggcccctaccagacc
ccgcagacccgggcacttctcagcatggccatcttctccacgggcatctgggtgacgggc
atcttcttcttccgccaaaccctgaagctgcttctctcctaccatgggtggatgtttgag
atgcatggcaagaccagcaacttgaccaggatctgggctatgtgtgtccgccttctatcc
agccggcaccccatgctctacagcttccagacatctctgcccaagcttcctgtgcccagg
gtgtcagccacaattcagcggtacctagagtctgtgcgccccttgttggatgatgaggaa
tattaccgcatggagatgctggccaaagaattccagaacaagactgcccccaggctgcag
aaatacctggtgctcaagtcatggtgggcgagtaactatgtgagtgactggtgggaagag
tacatctaccttcgaggcaggagccctctcatggtgaacagcaactactatgtcatggac
cttgtgctcatcaagaatacagacgtgcaggcagcccgcctgggaaacaccatccacgcc
atgatcatgtatcgccgtaaactggaccgtgaagaaatcaagcctgtgatggcactaggc
atagtgcccatgtgctcctatcagatggagaggatgttcaacaccactcgggtcccgggc
aaggagacagatgtgctgcagcacctctcagacagccggcacgtggctgtctaccacaag
ggacgcttcttcaagctgtggctctatgagggctcccgtctgctcaagcctcaggatctg
gagatgcagttccagaggatcctggacgacccctccccacctcagcctggggaggagaag
ctggcagccctcactgcaggaggaagggtggagtgggcgcaggcacgccaggccttcttt
agctctggaaagaacaaggctgccttggaggccatcgagcgtgccgctttcttcgtggcc
ctggatgaggagtcctaccgctatgaccccgaagacgaggccagcctcagcctctatggc
aaggccctgctacatggcaactgctacaacaggtggtttgacaaatccttcactcttatt
tccttcaagaatggccagctgggtctcaatgcagagcatgcgtgggcagatgctcccatc
attggccacctctgggagtttgtcctgggcacagacagcttccacctgggctacacggag
actgggcactgcctgggcaaaccgaaccctgcgctcccacctcctacgcggctgcagtgg
gacattccaaaacagtgccaggcggtcatcgagagttcctaccaggtggccaaggcgctg
gcagacgatgtggagctgtactgcttccagttcctgccctttggcaaaggcctcatcaag
aagtgccggaccagccccgatgcctttgtgcagatcgcactgcagctggcgcacttccgg
gacaggggtaagttctgcctgacctatgaggcctcaatgaccagaatgttccgggaggga
cggactgagaccgtgcgttcctgtaccagcgagtccacagcctttgtgcaggctatggtg
gagaggtcccacgcgaaagcagacctgcgagatctcttccagaaagctgctaagaagcac
cagaatatgtaccgcctggccatgaccggggcagggatcgacaggcacctcttctgcctt
tacttggtctccaagtacctgggagtcagctctcctttcctcgctgaggtgctctcggaa
ccctggcgtctctccaccagccagatcccccaatcccagatccgcatgtttgacccagag
cagcaccccaatcacctgggtgctggaggtggctttggccctgtagcagatgatggctat
ggagtttcctacatgatcgcgggcgagaacacgatcttcttccacatctccagcaagttc
tcaagctcagagacgaatgcccagcgctttggaaaccacatccgccaagccctgctggac
ctcgctgatcttttccaagtgcccaagaccgacagctga

DBGET integrated database retrieval system