KEGG   Chlorocebus sabaeus (green monkey): 103224337
Entry
103224337         CDS       T04361                                 

Gene name
PRMT6
Definition
(RefSeq) protein arginine methyltransferase 6
  KO
K11437  type I protein arginine methyltransferase [EC:2.1.1.319]
Organism
csab  Chlorocebus sabaeus (green monkey)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csab03036]
    103224337 (PRMT6)
Enzymes [BR:csab01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.319  type I protein arginine methyltransferase
     103224337 (PRMT6)
Chromosome and associated proteins [BR:csab03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     103224337 (PRMT6)
SSDB
Motif
Pfam: Methyltransf_25 PrmA Methyltransf_11 Methyltransf_9 MTS Met_10 Methyltransf_23 CMAS Methyltransf_31 Methyltransf_18 Methyltransf_12 PRMT5 Methyltransf_24 Ubie_methyltran Cons_hypoth95 NNMT_PNMT_TEMT Methyltransf_16 PCMT DREV FtsJ
Other DBs
NCBI-GeneID: 103224337
NCBI-ProteinID: XP_007975970
Ensembl: ENSCSAG00000000161
UniProt: A0A0D9SAE2
Position
20
AA seq 375 aa
MSQPKKRKLESGGGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYECYSDVSVHEEM
IADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQA
REVVRFNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKE
GGLLLPASAELFIAPISDQMLEWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQG
LSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGE
SEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYK
VGDQEEKTKDFAMED
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgtcgcagcccaagaaaagaaagcttgagtcggggggcggcggcgaaggaggggaggga
actgaagaggaagatggcgcagagcgggaggcggccctggagcgaccccggaggactaag
cgggagcgggaccagctgtactatgagtgctactcggacgtttcggtccacgaggagatg
atcgcagaccgcgtccgcaccgatgcctaccgcctgggtatcctgcggaactgggcagca
ctgcgaggcaagacggttcttgacgtgggcgcgggcaccggcattctgagtatcttctgt
gcccaggccggggcccggcgcgtgtacgcggtagaggccagcgccatctggcaacaggcc
cgggaggtggtaaggttcaacgggctggaggaccgggtgcacgtcctgccgggaccggtg
gagactgtggagttgccggaacaggtggatgccatcgtgagcgaatggatgggctacgga
ctcctgcacgagtccatgctgagctccgtcctccacgcgcgaaccaagtggctgaaggag
ggcggtcttctcctgccggcctccgccgagctcttcatagcccctatcagcgaccagatg
ctggaatggcgcctgggcttctggagccaggtgaagcagcactatggtgtggacatgagc
tgcctggagggcttcgccacgcgctgcctcatgggccattcggagatcgttgtgcaggga
ttgtccggcgaggacgtgctggcccggccgcagcgctttgcgcaactagagctctcccgc
gccggcttggagcaggagctggaggccggagtgggcgggcgcttccgctgcagctgctat
ggctcggcgcccatgcatggctttgccatctggttccaggtgaccttccctggaggggag
tcggagaaacccctggtgctgtccacctcgccttttcaccccgccacgcactggaaacag
gcgcttctctacctaaacgagccagtgcaagtggagcaagacacggatgtttcaggagag
atcacgctgctgccctcccgggacaacccccgtcgcctgcgcgtgctgctgcgctacaaa
gtgggagaccaggaggagaagaccaaagactttgccatggaggactga

DBGET integrated database retrieval system