KEGG   Chlorocebus sabaeus (green monkey): 103224968
Entry
103224968         CDS       T04361                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
csab  Chlorocebus sabaeus (green monkey)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:csab01002]
    103224968 (ERAP1)
Enzymes [BR:csab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     103224968 (ERAP1)
Peptidases and inhibitors [BR:csab01002]
 Metallo peptidases
  Family M1
   103224968 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 103224968
NCBI-ProteinID: XP_007977292
Ensembl: ENSCSAG00000014309
Position
4
AA seq 941 aa
MVFPSLIWSLATMSFLLSSLLALLTVSTPSWCQSSEASPKGSNGMPFPWNKMRLPEYVIP
VHYDLLIHANLTTLTFWGTTEVEITASQPTSAIILHSHHLQISRATLRKGAGERLSEEPL
QVLEHPPQEQIALLAPEPLLVGLLYTVVIHYAGNLSETFHGFYKSTYRTKEGELRILAST
QFEPTAARMAFPCFDEPAFKASFSIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVTV
KMSTYLVAFIISDFESVSKITKSGVKVSVYAVPDKINQADYALDAAVTLLDFYEDYFNIP
YPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSSASSKLGITMIVAHELAHQWF
GNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFFGKCFDAMEVDALNSSHPVS
TPVENPAQIREMFDDVSYDKGACILNMLREYLSADAFKSGIVQYLQKHSYKNTKNEDLWD
SMASICPTDGVKGMDGFCSRSQHSSSFSHWHQEGLDVKTMMNTWTLQKGFPLITITVRGR
NVHMKQEHYMKGSEGAPDTGYLWHVPLTFITSKSDMVHRFLLKTKTDVLILPEEVEWIKF
NVGMNGYYIVHYEDDGWDSLTGLLKGTHTAVSSNDRASLINNAFQLVSIGKLSIEKALDL
SLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEG
SVSERMLRSQLLLLACVRKYQPCVQRAEGYFRKWKESTGNLSLPIDVTLAVFAVGAQSTE
GWDFLYSKYQSSLSSTEKQQIEFALCTTQNKEKLQWLLDESFKGDKIKTQEFPGILVHIG
RNPVGYPLAWKFLRKNWNKLVQKFELGSHSIAHMVMGTTNQFSTRTWLEEVKGFFSSLKE
NGSQLRCVQQTIETIEENIRWMDKNFDKIRVWLQSEKFELL
NT seq 2826 nt   +upstreamnt  +downstreamnt
atggtgtttccgtccctcatatggtcccttgcaaccatgtcatttctactttcctcactg
ttggctctcttaactgtatccactccttcatggtgtcagagcagtgaagcatctccaaaa
ggtagtaatgggatgccatttccttggaataaaatgcgacttcctgagtatgtcatccca
gttcattatgatctcctgatccatgcaaaccttaccacgctgaccttctggggaaccacg
gaagtagaaataacagccagtcagcccaccagcgccatcatcctgcatagtcaccacctg
cagatatctagggccaccctcaggaaaggagctggagagaggctatcggaagaaccgctt
caggtcctggaacaccctcctcaggagcaaatcgcactgctggctcctgagcccctcctt
gtcgggctcctgtacacagttgtcattcactatgctggcaatctttcggagactttccac
ggattttacaaaagcacctacagaaccaaggaaggggaactgaggatacttgcatcaaca
caatttgaacccactgcagctagaatggcctttccctgctttgatgaacctgccttcaaa
gcaagtttctcaatcaaaattagaagagagccaaggcacctagccatctccaatatgcct
ttggtgaaatctgtgactgttgctgaaggactcatagaagaccattttgatgtcactgtg
aagatgagcacctatctggtggccttcattatttcagattttgagtctgtcagcaagata
accaagagtggagtcaaggtttctgtatatgctgtgccagacaagataaatcaagcagat
tatgcactggatgctgcggtgactcttctagatttttatgaggattatttcaacataccg
tatcccctacccaaacaagatcttgctgctattccggactttcagtctggtgctatggaa
aactggggactaacaacatatagagaatctgctctattgtttgatgcggaaaagtcttct
gcatcaagcaagcttggcatcacaatgattgtggcccatgaactggcccaccagtggttt
gggaacctggtcactatggaatggtggaatgatctgtggctaaatgagggatttgccaaa
tttatggagtttgtgtctgtcagtgtgactcatcctgaactgaaagttgaagattatttc
tttggcaaatgttttgatgcgatggaggtagatgctttaaattcctcacaccctgtgtct
acacctgtggagaatcctgctcagatccgggagatgtttgatgatgtttcttatgataag
ggagcttgtattctgaacatgctaagggagtatcttagtgctgatgcatttaaaagtggt
attgtacagtatctccagaagcatagctataaaaatacaaaaaacgaggacctgtgggat
agtatggcaagtatttgccctacagacggtgtaaaagggatggatggcttttgctctaga
agtcaacattcatcttcattctcacattggcatcaggaagggctggatgtgaaaaccatg
atgaacacttggacactgcagaagggttttcccctgataaccatcacagtgaggggaagg
aatgtacacatgaagcaagagcactacatgaagggctctgaaggcgccccggacactggg
tacctgtggcatgttccactgacgttcatcaccagcaaatcagacatggtccatcgattt
ttgctaaaaacaaaaacagatgtgctcatcctcccagaagaggtggaatggatcaaattt
aatgtgggcatgaatggctattacattgtgcattacgaggatgatggatgggactctttg
actggccttttaaaaggaacacacacagcagtgagcagtaacgatcgggcgagtctcatt
aacaatgcatttcagctcgtcagcatcgggaagctgtccattgaaaaggccttggattta
tccctgtacttgaaacatgaaactgaaattatgcccgtatttcaaggtttgaatgagctg
attcctatgtataagttaatggagaaaagagatatgaatgaagtggaaactcaattcaag
gccttcctcatcaggctgctaagggacctcattgataagcagacgtggacagatgaaggc
tcggtctcagagcgaatgctgcggagtcagctactcctcctcgcctgtgtgcgcaagtat
cagccgtgcgtacagagggcagaaggctatttcaggaagtggaaggaatccactggaaac
ttgagcctgcctatcgatgtgaccttggcagtgtttgctgtgggggcccagagcacagaa
ggctgggattttctttatagtaaatatcagtcttctttgtccagtactgagaaacaacaa
attgaatttgccctctgcacaacccaaaataaggaaaagcttcaatggctactagatgaa
agctttaagggagataaaataaaaactcaggagtttccaggaattcttgtacacattggc
aggaacccagtaggatacccactggcctggaaatttctcaggaaaaactggaacaaactt
gtacagaagtttgaacttggctcacattccatagcccacatggtaatgggtacaacaaat
caattctccacaagaacatggcttgaagaggtaaaaggattcttcagctctttgaaagaa
aatggttctcagctccgttgtgtccaacagacaattgaaaccattgaagaaaacatccgg
tggatggataagaattttgataaaatcagagtgtggctgcaaagtgaaaagtttgaactt
ctgtaa

DBGET integrated database retrieval system