KEGG   Chlorocebus sabaeus (green monkey): 103227435Help
Entry
103227435         CDS       T04361                                 

Gene name
ENTPD3
Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 3
  KO
K01510  apyrase [EC:3.6.1.5]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00230  Purine metabolism
csab00240  Pyrimidine metabolism
csab01100  Metabolic pathways
csab05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103227435 (ENTPD3)
   00240 Pyrimidine metabolism
    103227435 (ENTPD3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    103227435 (ENTPD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:csab04090]
    103227435 (ENTPD3)
Enzymes [BR:csab01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     103227435 (ENTPD3)
CD molecules [BR:csab04090]
 Proteins
  103227435 (ENTPD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39 DUF3739
Motif
Other DBs
NCBI-GeneID: 103227435
NCBI-ProteinID: XP_007981927
Ensembl: ENSCSAG00000016913
UniProt: A0A0D9RWH2
Position
22
AA seq 534 aa AA seqDB search
MLGEKMFTVLTRQPCEQAGLKALYRTPTIIALVVLLVSIVVLVSITVIQIHKQEVLPPGL
KYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPKAFED
CMQKVKGQVPFHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIRSYFKSQPFDFRGAQ
IISGQEEGVYGWITANYLMGNFLEKSLWHMWVHPHGVETTGALDLGGASTQISFVAGEKV
DLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCYPRDYS
INFTMGHVFDSLCTVDQRPESYNPSDIITFEGTGDPSLCKEKVASLFDFKACHDQETCSF
DGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFDE
VYARSYCFSANYIYHLFVNGYKFTEETWPHIHFEKEVGNSSIAWSLGYMLSLTNQIPAES
PLIRLPIEPPVFVGTLAFFTAAALLCLAFLAYLCSASRKKRRSEHAFDHAVDSD
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgctgggagaaaagatgttcactgtgctgacccgccaaccatgtgagcaagcaggcctc
aaggccctctaccgaactccaaccattattgccttggtggtcttgcttgtgagtattgtg
gtgcttgtgagtatcactgtcatccagatccacaaacaagaggtcctccctccaggactg
aagtatggtattgtgctggatgccgggtcttctagaaccacagtctacgtgtatcaatgg
ccagctgagaaagagaataataccggagtggtcagtcaaaccttcaaatgtagtgtgaaa
ggctctggaatctccagctatggaaataatccccaagatgtccccaaagcctttgaggat
tgtatgcaaaaagtcaaggggcaggttccatttcacctccacggctccacccccattcac
ctgggagccacagctgggatgcgcttgctaaggttgcaaaatgaaacagcagctaatgaa
gtccttgaaagcatccgaagctacttcaagtcccagccctttgactttaggggtgctcaa
atcatttctgggcaagaggaaggggtatatggatggattacggccaactatttaatggga
aatttcctggagaagagcctttggcatatgtgggtgcacccgcatggagtggaaaccacg
ggtgccctggacttaggtggtgcctccacccaaatatccttcgtggcaggagagaaggtg
gatctgaacaccagcgacatcatgcaggtgtccctgtatggctacgtgtacacgctctac
acacacagcttccagtgctatggccggaatgaggctgagaagaagtttctggcaatgctc
ctgcagaattctcctaccaaaaaccatctcaccaatccctgttaccctcgggattatagc
atcaacttcaccatgggccatgtatttgatagcctgtgcactgtggaccagaggccagaa
agttataaccccagtgatatcatcacttttgagggaactggggacccatctctgtgtaag
gagaaggtggcttccttatttgacttcaaagcttgccatgatcaagaaacgtgttctttt
gatggggtttatcagccaaagattaaagggccgtttgtggcttttgcaggattctactac
acagccagtgctttaaatctttcaggtagcttttccctggacaccttcaactccagcacc
tggaatttctgctcacagaattggagtcagctcccactcctgctgcccaaatttgatgag
gtatacgcccgctcttactgcttctcagccaactatatctaccacttgtttgtgaacggt
tacaaattcacagaggagacttggccccacatacattttgaaaaagaagtggggaatagc
agcatagcctggtctcttggctacatgctcagcctgaccaaccagatcccagctgaaagc
cctctgatccgtctgcccatagaaccacctgtctttgtgggcaccctcgctttcttcaca
gcggcagccttgctgtgtctggcatttcttgcgtacctgtgttcagcatccagaaaaaag
aggcgctccgagcatgcctttgaccatgcagtggattctgactga

DBGET integrated database retrieval system