KEGG   Chlorocebus sabaeus (green monkey): 103228101Help
Entry
103228101         CDS       T04361                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00561  Glycerolipid metabolism
csab01100  Metabolic pathways
csab04714  Thermogenesis
csab04723  Retrograde endocannabinoid signaling
csab04923  Regulation of lipolysis in adipocytes
Module
csab_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:csab00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    103228101 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    103228101 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    103228101 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    103228101 (MGLL)
Enzymes [BR:csab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103228101 (MGLL)
Peptidases [BR:csab01002]
 Serine Peptidases
  Family S33
   103228101 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Abhydrolase_3 DLH Abhydrolase_5 PGAP1 Thioesterase LIDHydrolase BAAT_C DUF1057 Abhydrolase_2 DUF1350 FSH1 DUF2974
Motif
Other DBs
NCBI-GeneID: 103228101
NCBI-ProteinID: XP_007983649
Ensembl: ENSCSAG00000008560
Position
22
AA seq 313 aa AA seqDB search
METGSEDPSRMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHG
AGEHCGRYEELAQMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKD
YPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLV
LPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVP
FLLLQGSADRLCDSKGAYLLMESAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWV
SQRTATAGTASPP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggatctgaagacccttccagaatgccagaggaaagttcccccaggcggacc
ccgcagagtattccctaccaggatctccctcacttggtcaatgcagacggacagtacctc
ttctgcaggtactggaaacccacaggcacacccaaggccctcatctttgtgtcccatgga
gccggagagcactgtggccgctatgaagagctggctcagatgctgatggggctggacctg
ctggtgttcgcccacgaccatgttggccacggacagagcgaaggggagaggatggtagtg
tctgacttccacgttttcgtcagagatgtgttgcagcatgtggattccatgcagaaagac
taccccgggcttcctgtcttccttctgggccactccatgggaggtgccatcgccatcctc
acggccgcagagaggccgggccacttcgccggcatggtactcatttcacctctggttctt
gccaatcctgaatctgcaacaactttcaaggtccttgctgcgaaagtgctcaaccttgtg
ctgccaaacttgtccctcgggcccatcgactccagcgtgctctctcggaataagacagag
gtcgacatttataactcagaccccttgatctgccgggcagggctgaaggtgtgctttggc
atccagctgctgaatgctgtctcacgggtggagcgcgccctccccaagctgacggtgccc
ttcctgctgctccagggctctgccgatcgcctgtgtgacagcaaaggggcttacctgctc
atggagtcagccaagagccaggacaagactctcaagatttatgaaggtgcctaccacgtt
ctccacaaagagcttcctgaagtcaccaactccgtcttccatgaaataaacatgtgggtc
tctcaaaggacagccacggcaggaactgcgtccccaccgtga

DBGET integrated database retrieval system