KEGG   Chlorocebus sabaeus (green monkey): 103228726
Entry
103228726         CDS       T04361                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00230  Purine metabolism
csab01100  Metabolic pathways
csab01522  Endocrine resistance
csab04015  Rap1 signaling pathway
csab04020  Calcium signaling pathway
csab04022  cGMP-PKG signaling pathway
csab04024  cAMP signaling pathway
csab04062  Chemokine signaling pathway
csab04072  Phospholipase D signaling pathway
csab04114  Oocyte meiosis
csab04211  Longevity regulating pathway
csab04213  Longevity regulating pathway - multiple species
csab04261  Adrenergic signaling in cardiomyocytes
csab04270  Vascular smooth muscle contraction
csab04371  Apelin signaling pathway
csab04540  Gap junction
csab04611  Platelet activation
csab04713  Circadian entrainment
csab04714  Thermogenesis
csab04723  Retrograde endocannabinoid signaling
csab04724  Glutamatergic synapse
csab04725  Cholinergic synapse
csab04727  GABAergic synapse
csab04742  Taste transduction
csab04750  Inflammatory mediator regulation of TRP channels
csab04911  Insulin secretion
csab04912  GnRH signaling pathway
csab04913  Ovarian steroidogenesis
csab04914  Progesterone-mediated oocyte maturation
csab04915  Estrogen signaling pathway
csab04916  Melanogenesis
csab04918  Thyroid hormone synthesis
csab04921  Oxytocin signaling pathway
csab04923  Regulation of lipolysis in adipocytes
csab04925  Aldosterone synthesis and secretion
csab04926  Relaxin signaling pathway
csab04927  Cortisol synthesis and secretion
csab04928  Parathyroid hormone synthesis, secretion and action
csab04934  Cushing syndrome
csab04935  Growth hormone synthesis, secretion and action
csab04970  Salivary secretion
csab04971  Gastric acid secretion
csab04972  Pancreatic secretion
csab04976  Bile secretion
csab05032  Morphine addiction
csab05163  Human cytomegalovirus infection
csab05166  Human T-cell leukemia virus 1 infection
csab05200  Pathways in cancer
csab05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103228726 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103228726 (ADCY4)
   04371 Apelin signaling pathway
    103228726 (ADCY4)
   04020 Calcium signaling pathway
    103228726 (ADCY4)
   04072 Phospholipase D signaling pathway
    103228726 (ADCY4)
   04024 cAMP signaling pathway
    103228726 (ADCY4)
   04022 cGMP-PKG signaling pathway
    103228726 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103228726 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103228726 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103228726 (ADCY4)
   04062 Chemokine signaling pathway
    103228726 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    103228726 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    103228726 (ADCY4)
   04912 GnRH signaling pathway
    103228726 (ADCY4)
   04913 Ovarian steroidogenesis
    103228726 (ADCY4)
   04915 Estrogen signaling pathway
    103228726 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    103228726 (ADCY4)
   04921 Oxytocin signaling pathway
    103228726 (ADCY4)
   04926 Relaxin signaling pathway
    103228726 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    103228726 (ADCY4)
   04918 Thyroid hormone synthesis
    103228726 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    103228726 (ADCY4)
   04916 Melanogenesis
    103228726 (ADCY4)
   04925 Aldosterone synthesis and secretion
    103228726 (ADCY4)
   04927 Cortisol synthesis and secretion
    103228726 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103228726 (ADCY4)
   04270 Vascular smooth muscle contraction
    103228726 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    103228726 (ADCY4)
   04971 Gastric acid secretion
    103228726 (ADCY4)
   04972 Pancreatic secretion
    103228726 (ADCY4)
   04976 Bile secretion
    103228726 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    103228726 (ADCY4)
   04727 GABAergic synapse
    103228726 (ADCY4)
   04725 Cholinergic synapse
    103228726 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    103228726 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    103228726 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    103228726 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    103228726 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    103228726 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103228726 (ADCY4)
   04714 Thermogenesis
    103228726 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103228726 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    103228726 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    103228726 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103228726 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103228726 (ADCY4)
   05163 Human cytomegalovirus infection
    103228726 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103228726 (ADCY4)
Enzymes [BR:csab01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103228726 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N DUF3180 CD52
Other DBs
NCBI-GeneID: 103228726
NCBI-ProteinID: XP_007984518
Ensembl: ENSCSAG00000015893
Position
24
AA seq 1164 aa
MMLRRDKTKCGRRPGESGFGTGRGRAVPSGKWEGGRGAWREAPVARDSEPERSGDSTIRS
PAPSLGLAHSAAPAPRAPASGLWAGEIMARLFSPRPPLSEDLFYETYYSLSQQYPLLLLL
LGIVLCALAALLAVAWASGRELTSDPSFLTTVLCALGGFSLLLGLASREQRLQRWTRPLS
GLVWVALLALGHAFLFTGGVVSAWDQVSYFLFVIFTVYAMLPLGMRDAAVAGLASSLSHL
LVLGLYLGPQPDSRPALLPQLAANAVLFLCGNVAGVYHKALMERALRATFREALSSLHSR
RRLDTEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQGSRPESTNNFHSLYVKRHQGVS
VLYADIVGFTRLASECSPKELVLMLNELFGKFDQIAKEHECMRIKILGDCYYCVSGLPLS
LPDHAINCVRMGLDMCRAIRKLRAATGVDINMRVGVHSGSVLCGVIGLQKWQYEVWSHDV
TLANHMEAGGVPGRVHITGATLALLAGAYAVEEAGMEHRDPYLRELGEPTYLVIDPRAEE
EDEKGTAGGLLCSLEGPKMRPSLLMTRYLESWGAAKPFAHLSHVDSPVSTSTPLQEKTLA
SFSPQWSLDRSRTLRGLDDELDTGDAKFFQVIEQLNSQKQWKQSKDFNPLTLYFREKEME
KEYRLSAIPAFKYYEACTFLVFLSNFIIQMLVTNRPPALAITYSITFLLFLLLLFVCFSE
DLMRCVLKGPKMLHWLPALSGLVATRPGLRIALGTATILLVFAMAITSLFFFPASSDCPF
QAPNVSSMISNLSWELPGSLPLISVPYSMHCCTLGFLSCSLFLHMSFELKLLLLLLWLAA
SCSLFLHSHAWLSDCLIVRLYLGPLDSRPGVLKEPKLMGAISFFIFFFTLLVLARQNEYY
CRLDFLWKKKLRQEREETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSXECVC
VLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMA
ATGLNATSGQDAQQDAERSCSHLGTMVEFAVALGSKLDVINKHSFNNFRLRVGLNHGPVV
AGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETAWALQSLGYTCYSRGVIKVKG
KGQLCTYFLNTDLTRSGPPSVTLG
NT seq 3495 nt   +upstreamnt  +downstreamnt
atgatgttaaggagagacaaaaccaagtgcgggaggagaccaggggagtccggcttcggc
acaggaaggggccgggctgtcccgtcggggaagtgggaggggggccgcggcgcctggagg
gaagcgcctgtcgccagggactctgagccagagcgcagcggcgactccaccatcaggtcc
ccggctccctccctgggcctagcccactccgctgcgccagcgccgcgggcaccagcctcg
ggactctgggcgggggagatcatggcccgcctcttcagcccccggccacccctcagcgaa
gacctcttctacgagacctactacagcctgagccagcagtacccgctgctgctgctgctg
ctggggatcgtgctctgtgcgctcgcggcgctgctcgcggttgcctgggccagcggcagg
gagctgacctcagacccgagcttcctgaccactgtgctgtgcgcgctgggcggcttctcg
ctgctgctgggcctcgcttcccgcgagcagcgactgcagcgctggacgcgtcctctctcc
ggcttggtatgggtcgcgctgctagcgctaggccacgccttcctgttcaccgggggcgtg
gtgagcgcctgggaccaggtgtcctattttctcttcgtcatcttcacggtgtatgccatg
ctgcccttgggcatgcgggacgccgccgtcgcgggcctcgcctcctcactctcgcatcta
ctggtcctggggctgtatcttgggccacagccggactcacggcctgcactgctgccgcag
ttggcagcaaatgcggtgctgttcctgtgcgggaatgtcgcaggagtgtaccacaaggcg
ctgatggagcgcgccctgcgggccacgttccgggaggcactcagctccttgcactcgcgc
cggcggctggacaccgaaaagaagcaccaggaacaccttctcttgtccatccttcctgcc
tacctggcccgagagatgaaagcagagatcatggcacggctgcaggcaggacaggggtca
cggccagagagcaccaacaatttccacagcctctatgtcaagagacaccagggagtcagt
gtgctgtatgctgacattgtgggcttcacacggctggccagcgagtgttcccctaaggag
ctggtgctcatgctcaatgagctctttggcaagttcgaccagatcgccaaggagcatgaa
tgcatgcggatcaagatcctgggggactgttactactgtgtctccggactgccactctcc
ctgccagaccatgccatcaactgcgtgcgcatggggctggacatgtgccgggccatcagg
aaactgcgggcagccactggcgtggacatcaacatgcgtgtgggcgtgcactcaggcagt
gtactctgtggagtcatcgggctgcagaagtggcagtatgaggtttggtcccatgatgtc
acactggctaaccacatggaggcaggcggtgtaccagggcgagtgcacatcacaggcgct
accctggccctgctggcaggggcttatgctgtggaggaggcaggcatggagcatcgggat
ccctaccttcgggagctaggggagcccacctatctggtcatcgatccacgggcagaggag
gaggatgagaagggcactgcaggaggcttgctctgctcgcttgagggccccaagatgcgt
ccatcactgctgatgacccgttacctggagtcctggggtgcagccaagccttttgcccac
ctgagccacgtagacagccctgtgtccacctccacccctctccaggagaagaccctggct
tccttcagcccccagtggagcctagatcggagccgtaccctccgtggactagatgatgaa
ctggacaccggggatgccaagttcttccaggtcattgagcagctcaactcacagaaacag
tggaagcagtcgaaggacttcaacccactgacactgtacttcagagagaaggagatggag
aaagagtaccgactctctgcaatccccgccttcaaatactatgaagcctgcaccttcctg
gtttttctctccaacttcatcatccagatgctagtgacaaacaggcccccagctctggcc
atcacgtatagcatcaccttcctcctcttcctcctcctcctttttgtctgcttctcagag
gacctgatgaggtgtgtcctgaaaggccccaagatgctgcactggctgcctgcactgtct
ggcctggtggccacacgaccaggactgagaatagccttgggcaccgccaccatcctcctt
gtctttgccatggccattaccagcctgttcttcttcccagcatcatcagactgccctttc
caagctcccaatgtgtcctccatgatttccaacctctcctgggagctccctgggtctctg
cctctcatcagtgtcccatactccatgcactgctgcacgctgggcttcctctcctgctcc
ctctttctgcacatgagcttcgagctgaagctgctgctgctcctgctgtggctggcggca
tcctgctccctcttcctgcactcccacgcctggctgtccgactgcctcatcgtccgcctc
tatctgggccccttggactccaggcccggagtgctgaaggagcccaaactcatgggtgct
atctccttcttcatcttcttcttcaccctccttgtcctggctcgccagaatgagtactac
tgccgcctggacttcctgtggaagaagaagctgaggcaggagcgggaggagacagagacg
atggagaacctgactcggctgctcttggagaacgtgctccctgcacacgtggccccccag
ttcattggccagaaccggcgcaacgaggatctctaccaccagtcctaggaatgcgtttgt
gtcctcttcgcttcagtcccagacttcaaggagttctactctgaatccaacatcaatcat
gagggcctagagtgtctgaggctgctcaatgaaataattgctgattttgatgagctactc
tccaagcccaagttcagtggggtggagaagatcaagaccattgggagcacctacatggca
gccacaggattaaatgccacctctggacaggatgcacaacaggatgctgaacggagctgc
agccaccttggcactatggtggaatttgccgttgccctggggtctaagctggacgtcatc
aacaagcattcattcaacaacttccgcctgcgtgtggggttgaaccatggaccagtagta
gctggagttattggggcccagaagccacaatatgacatttggggcaacacagtgaacgtg
gccagccgcatggagagtacaggagtccttggcaaaatccaagtgactgaggagacagcc
tgggccctacagtccctgggctacacctgctacagccggggggtcatcaaggtgaaaggt
aaagggcagctctgcacctacttcctgaacacagacttgacacgaagtggacctccttca
gttaccctaggctga

DBGET integrated database retrieval system