KEGG   Chlorocebus sabaeus (green monkey): 103228727Help
Entry
103228727         CDS       T04361                                 

Gene name
LTB4R
Definition
(RefSeq) leukotriene B4 receptor
  KO
K04296  leukotriene B4 receptor 1
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103228727 (LTB4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:csab04030]
    103228727 (LTB4R)
G protein-coupled receptors [BR:csab04030]
 Rhodopsin family
  Lipid
   Leukotriene
    103228727 (LTB4R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 103228727
NCBI-ProteinID: XP_007984519
Ensembl: ENSCSAG00000019397
UniProt: A0A0D9SDG6
Position
24
AA seq 353 aa AA seqDB search
MNTTSSAASPSLGVGFIFLLAIILLSVALAVGLPGNSFVVWSILKRMKKRSVTALLVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSMAVA
RPFVSQKLRTKAMALRVLAGIWVVSFLLATPVLVYRTVVASKTNNMSLCSPKYPSKEHQA
FHLIFEAITGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILAFAAFWLPYHV
VNLAEAARALAGQASGSGLVGQRLKLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVG
FVAKLLEGTGSEASSTRRGGSLGQTVRGGPAALEPGPSESLTASSPLELNELN
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaacactacatcttctgcagcatccccctcactaggtgtagggttcatctttctgttg
gctatcatcctgctgtcagtggcgctggctgtggggcttcccggcaacagctttgtggtg
tggagcatcttgaaaaggatgaagaagcgctctgtcactgccctgttggtgctgaacctg
gccctggccgacctggccgtattgctcactgctccctttttccttcacttcctggcccaa
ggcacctggagttttggattggctggttgtcgcctgtgccactatgtctgtggagtcagc
atgtacgccagtgtcctgcttatcacagccatgagtctagaccgctcaatggcagtggcc
cgcccctttgtgtcccagaagctacgcaccaaggcaatggccctgcgggtgctggcaggc
atctgggtggtgtcctttctcctggccacacccgtcctcgtgtaccgcacagtagtggcc
tcgaaaacgaacaacatgagcctgtgctctccgaagtaccccagcaaggagcaccaggcc
ttccatctaatcttcgaggccatcactggcttcctgttacccttcctggctgtggtggcc
agctactccgacatagggcgtcggctgcaggcccggcgcttccgccgcagccgccgcact
ggtcgcctggtggtgctcatcatcctggccttcgccgccttctggctgccctaccacgtg
gtgaacctggccgaggccgcccgtgcactggccggccaggcctccgggtcggggctcgtg
gggcagcggctgaaactggcccgcaacgtactcatcgcgctcgccttcctgagcagcagc
gtgaaccccgtgctgtacgcgtgcgccggcggcggcctgctacgctcggcgggcgtgggc
ttcgtcgccaagctgctggagggcacgggctccgaggcgtccagcacccgccgcgggggc
agcctgggccagaccgtgaggggcggccccgccgctctggagcccggcccttctgagagc
ctcactgcctccagccctctcgagttaaacgaactgaactag

DBGET integrated database retrieval system