KEGG   Chlorocebus sabaeus (green monkey): 103229165
Entry
103229165         CDS       T04361                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
csab  Chlorocebus sabaeus (green monkey)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:csab01009]
    103229165 (AKAP5)
Protein phosphatases and associated proteins [BR:csab01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     103229165 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 103229165
NCBI-ProteinID: XP_007985147
Ensembl: ENSCSAG00000019567
UniProt: A0A0D9SDX7
Position
24
AA seq 427 aa
METTVSEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKVGSEAADVAR
KCPQEAGASDQPEPPRGAWASLKRLVTRRKRSESSKQQKPLEAEVQPAINAEDADLSKKK
AKSRLKIPCIKFPRGPKRSSHSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQ
DLSEGISRKDGDEVCESNVSNSITSGEKVISVELGLDDGHSAIQTGTLILEEIETVKEKQ
DVQPQQAGPLETSETDHQQTVLSDVPPLPAIPAQQIMEEASNNILKSAPNGKDYESREIV
AEETKPKDTELSQESDFKENGITEEKSKLEESKRIEPIAIIITDTEISEFDVKKSKNVPK
QFLISTENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDN
KINNLLQ
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggaaaccacagtttcagaaattcatgtagaaaacaaggatgagaagagatcggcagaa
ggtagtcctggggctgaaagacagaaggaaaaggcatccatgctttgcttcaagagaaga
aagaaagcagctaaagcactgaagcccaaagttggctctgaagctgctgatgtggcaagg
aagtgtccccaagaagcaggagcttctgatcagccagagcccccacggggggcctgggcc
tcactcaaacgtcttgtaacacgcaggaaaaggtcagagtcttcaaagcagcaaaagcca
ttggaggctgaagtgcaacctgcaataaacgctgaggatgctgatctttctaagaaaaag
gcaaaatctagacttaagattccctgcataaaattcccaagagggccaaaaaggagtagt
cattccaaaatcatagaagactcagactgcagcatcaaagtccaggaagaagctgaaatt
ttggatatacaaacacagaccccattgaatgatcaagcaacaaaggctaagtcaacccag
gatctaagtgaaggcatctcacggaaagatggtgatgaagtctgtgaatcaaatgtgagc
aatagcataacttctggagagaaagtgatttcagtagaacttggattagatgatgggcat
tctgctattcaaacaggaactctaatccttgaagaaattgaaacggtcaaggaaaaacaa
gatgttcaaccccagcaagcaggcccacttgaaacttcagaaacagaccatcagcaaaca
gtactttctgatgttccacctttacctgcaatcccagctcaacaaattatggaagaagcc
agtaacaatatcctaaaaagtgcaccaaatgggaaagactatgaaagtagagagattgta
gctgaagaaactaagccaaaagatactgaattgagccaagaatcagattttaaagaaaat
ggaatcactgaagagaagtccaaattagaagaaagcaaacgaatagagccaattgctatt
attattacagacactgaaatcagtgaatttgatgttaagaaatcaaaaaatgtccctaag
caattcttaatttcaactgaaaatgagcaagtaggggtttttgctaatgataatggtttt
gaggatagaacttcagaacaatatgaaacactcttaattgaaacagcctcttctcttgtc
aagaatgctattcagttgtcaatagaacagcttgttaatgaaatggcctctgatgataat
aaaataaacaatcttctacagtga

DBGET integrated database retrieval system