KEGG   Chlorocebus sabaeus (green monkey): 103229992Help
Entry
103229992         CDS       T04361                                 

Gene name
PARP1
Definition
(RefSeq) poly(ADP-ribose) polymerase 1
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab03410  Base excision repair
csab04210  Apoptosis
csab04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:csab00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    103229992 (PARP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103229992 (PARP1)
   04217 Necroptosis
    103229992 (PARP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:csab03032]
    103229992 (PARP1)
   03036 Chromosome and associated proteins [BR:csab03036]
    103229992 (PARP1)
   03400 DNA repair and recombination proteins [BR:csab03400]
    103229992 (PARP1)
Enzymes [BR:csab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     103229992 (PARP1)
DNA replication proteins [BR:csab03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     103229992 (PARP1)
Chromosome and associated proteins [BR:csab03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    103229992 (PARP1)
DNA repair and recombination proteins [BR:csab03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     103229992 (PARP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg zf-PARP WGR PADR1 BRCT BRCT_2
Motif
Other DBs
NCBI-GeneID: 103229992
NCBI-ProteinID: XP_007986456
Position
25
AA seq 1014 aa AA seqDB search
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKS
NRSTCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPHCFVKNREELGFRPEYSASQ
LKGFSLLAAEDKEPLKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKA
QNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMAFGALLPCKECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPE
TSAPVVATPPPSTASAPAAGNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLT
GTATKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDISASTKSLQELFLAHILSP
WGAEVKAEPVEVVAPKGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLE
HSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVGTVIGSNK
LEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLDIDYGQDEEAVKKLTVNPG
TKSKLPKPVQDLIKLIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAXSILSEVQQAV
SQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNSADSVQAKVEMLDNLLDIEVAYSLLRG
GSDDSSKDPIDVNYEKLKTDIKVVGRDSEEAEIISKYVKNTHATTHNAYDLEVIDIFKIE
REGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
VSKSANYCHTSQGDPIGLIVLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA
SISLDGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtcttcggataagctctaccgagtcgagtacgccaagagcgggcgcgcctct
tgcaagaaatgcagcgagagcatccccaaggactcgctccggatggccatcatggtgcag
tcacccatgtttgatggaaaagtcccacactggtaccacttctcctgcttctggaaggtg
ggccattccatccggcaccctgacgtggaggtggatgggttctctgagcttcggtgggat
gaccagcagaaagtcaagaagacagcggaagctggaggagtgacaggcaaaggccaggat
ggaattggtagcaaggcagagaagacgctgggtgactttgcagcagagtatgccaagtcc
aacagaagcacatgcaaggggtgtatggagaagatagaaaagggccaggtgcgcctgtcc
aagaagatgctggacccggagaagccacagctaggcatgattgaccgctggtaccaccca
cactgctttgtcaagaacagggaggagctgggtttccggcccgagtacagtgcgagtcag
ctcaagggcttcagcctccttgctgcagaggataaagaacccctgaagaagcagctccca
ggagtcaagagcgaaggaaagagaaaaggcgatgaggtggatggagtagatgaagtggcc
aagaagaaatctaaaaaagaaaaagacaaagatagtaagcttgaaaaagctctaaaggct
cagaacgacctgatctggaacatcaaggacgagctaaagaaagtgtgttcaactaatgac
ctgaaggagctactcatcttcaacaagcagcaagtgccttctggggagtcggcgatcttg
gaccgagtagccgatggcatggcgttcggtgccctccttccctgcaaggaatgctcgggt
cagctggtcttcaagagtgatgcttattactgcactggggacgtcactgcctggaccaag
tgtatggtcaagacacagacacccaaccggaaggagtgggtaaccccaaaggaattccga
gaaatctcttacctcaagaaattgaaggttaaaaagcaggaccgtatattccccccagaa
accagcgccccggtggtggccacgcccccaccctccacagcttcggcgcctgctgctggg
aactcgtctgcttcagcagataagccattatccaacatgaagatcctgactcttgggaag
ctctcccggaacaaggatgaagtgaaggctatgattgagaaactcggggggaagttgaca
gggacagccactaaggcttccctgtgcatcagcaccaaaaaggaggtggaaaagatgaat
aagaagatggaggaagtaaaggaagccaacatccgagttgtgtctgaggacttcctccag
gacatctccgcctccaccaagagccttcaggagttgttcttagcacacatcttgtcccct
tggggggcagaggtgaaggcagagcctgtcgaagttgtggccccaaaagggaagtcaggg
gctgcactctccaaaaaaagcaagggccaggtcaaggaggaaggtatcaacaaatctgaa
aagagaatgaaattaactcttaaaggaggagcagctgtggatcctgattctggactggaa
cactctgcgcatgtcctggagaaaggtgggaaggtcttcagtgccaccctcggcctggtg
gacatcgttaaaggaaccaactcctattacaagctgcagcttctggaggacgacaaggaa
agcaggtattggatattcaggtcctggggccgtgtggggacggtgatcggtagcaacaaa
ctggaacagatgccgtccaaggaggatgccattgagcacttcatgaaattatatgaagaa
aaaaccgggaacgcttggcactccaaaaatttcacaaagtatcccaaaaagttctacccc
ctggacattgactacggccaggatgaagaggcagtgaagaagctgacagtaaatcctggc
accaagtccaagctccccaagccagttcaggacctcatcaagctgatctttgatgtggaa
agtatgaagaaagccatggtggaatatgagatcgaccttcagaagatgcccttggggaag
ctgagcaaaaggcagatccaggccgcgtagtccatcctcagtgaggtacagcaggcagtg
tctcagggcagcagcgactctcagatcctggatctctcaaatcgcttttacaccctgatc
ccccacgactttgggatgaagaagcctccgctcctgaacagtgcagacagtgtgcaggcc
aaggtggaaatgcttgacaacctgctggacatcgaggtggcctacagtctgctcagggga
gggtctgatgatagcagcaaggaccccatcgatgtcaactatgagaagctcaaaactgac
attaaggtggttggcagagattctgaagaagccgagatcatcagtaagtatgttaagaac
actcatgcaaccacacacaatgcgtatgacttggaagtcatcgatatctttaagatagaa
cgtgaaggcgaatgccagcgctacaagccctttaagcagcttcataaccgaagattgctg
tggcacgggtccaggaccaccaactttgccgggatcctgtcccagggtcttcggatagcc
ccgcctgaagcacctgtgacaggctacatgtttggtaaagggatctatttcgctgacatg
gtctccaagagtgccaactactgccatacgtctcagggagacccaataggcttaatcgtg
ttgggagaagttgcccttggaaacatgtatgaactgaagcacgcttcacatatcagcaag
ttacccaagggcaagcacagtgtcaaaggtttgggcaaaactacccctgacccttcagcc
agtattagtctggatggtgtagaggttcctcttgggaccgggatttcatctggtgtgaat
gacacctgtctactatataacgagtacattgtctacgatattgctcaggtaaatctgaag
tatctgctgaaactgaaattcaattttaagacctccctgtggtaa

DBGET integrated database retrieval system