KEGG   Chlorocebus sabaeus (green monkey): 103230457Help
Entry
103230457         CDS       T04361                                 

Gene name
NMNAT2
Definition
(RefSeq) nicotinamide nucleotide adenylyltransferase 2
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00760  Nicotinate and nicotinamide metabolism
csab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    103230457 (NMNAT2)
Enzymes [BR:csab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     103230457 (NMNAT2)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     103230457 (NMNAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 103230457
NCBI-ProteinID: XP_007987431
Ensembl: ENSCSAG00000012635
UniProt: A0A0D9RJM6
Position
25
AA seq 307 aa AA seqDB search
MTETTKTHVILLACGSFNPITKGHIQMFERARDYLHKTGRFIVIGGIVSPVHDSYGKQGL
VSSRHRLIMCQLAVQNSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTP
SMTPVIGQPQNETPQPIYQNSNVPTKPTAAKILGKVGESLSRICCVRPPVERFTFVDENA
NLGTVMRYEEIELRILLLCGSDLLESFCIPGLWNEADMEVIVGDFGIVVVPRDAADTDRI
MNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQ
LYINASG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaccaccaagacccacgttatcttgctcgcctgcggcagcttcaatcccatc
accaaagggcacattcagatgtttgaaagagccagggattatctgcacaaaactggaagg
tttattgtgattggcgggattgtctcccctgtccacgactcctatggaaaacagggcctc
gtgtcaagccggcaccgtctcatcatgtgtcagctggccgtccagaattccgactggatc
agggtggacccttgggagtgctaccaggacacctggcagacgacctgcagcgtgttggaa
caccaccgggacctcatgaagagggtgactggctgcatcctctccaatgtcaacacacct
tccatgacgcctgtgatcggacaaccacaaaacgagaccccccagcccatttaccagaac
agcaacgtgcccaccaagcccactgcagccaagatcttggggaaggtgggagaaagcctc
agccggatctgctgtgtccgcccaccggtggagcgtttcacttttgtagatgagaatgcc
aatctgggcacggtgatgcggtatgaagagatcgagctgcggatcctgctgctgtgtggt
agtgacctgctggagtccttctgcatcccggggctctggaacgaggcagatatggaggtg
attgttggcgactttgggattgtggtggtgccccgggatgcagccgacacagaccgaatc
atgaatcactcctcaatactccgcaaatacaaaaacaacatcatggtggtgaaggatgac
atcaaccatcccatgtctgttgtcagctcaaccaagagcaggctggccctccagcatggg
gacggccatgttgtggattacctgtcccagccggtcatcgactacatccttaaaagccag
ctgtacatcaatgcctccggctag

DBGET integrated database retrieval system