KEGG   Chlorocebus sabaeus (green monkey): 103230577Help
Entry
103230577         CDS       T04361                                 

Gene name
FASLG
Definition
(RefSeq) Fas ligand
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab01524  Platinum drug resistance
csab04010  MAPK signaling pathway
csab04014  Ras signaling pathway
csab04060  Cytokine-cytokine receptor interaction
csab04068  FoxO signaling pathway
csab04151  PI3K-Akt signaling pathway
csab04210  Apoptosis
csab04217  Necroptosis
csab04650  Natural killer cell mediated cytotoxicity
csab04722  Neurotrophin signaling pathway
csab04932  Non-alcoholic fatty liver disease (NAFLD)
csab04940  Type I diabetes mellitus
csab05142  Chagas disease (American trypanosomiasis)
csab05143  African trypanosomiasis
csab05160  Hepatitis C
csab05161  Hepatitis B
csab05162  Measles
csab05163  Human cytomegalovirus infection
csab05164  Influenza A
csab05165  Human papillomavirus infection
csab05168  Herpes simplex virus 1 infection
csab05170  Human immunodeficiency virus 1 infection
csab05200  Pathways in cancer
csab05205  Proteoglycans in cancer
csab05320  Autoimmune thyroid disease
csab05330  Allograft rejection
csab05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103230577 (FASLG)
   04010 MAPK signaling pathway
    103230577 (FASLG)
   04068 FoxO signaling pathway
    103230577 (FASLG)
   04151 PI3K-Akt signaling pathway
    103230577 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103230577 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103230577 (FASLG)
   04217 Necroptosis
    103230577 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103230577 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103230577 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103230577 (FASLG)
   05205 Proteoglycans in cancer
    103230577 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103230577 (FASLG)
   05330 Allograft rejection
    103230577 (FASLG)
   05332 Graft-versus-host disease
    103230577 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103230577 (FASLG)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103230577 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103230577 (FASLG)
   05162 Measles
    103230577 (FASLG)
   05164 Influenza A
    103230577 (FASLG)
   05161 Hepatitis B
    103230577 (FASLG)
   05160 Hepatitis C
    103230577 (FASLG)
   05168 Herpes simplex virus 1 infection
    103230577 (FASLG)
   05163 Human cytomegalovirus infection
    103230577 (FASLG)
   05165 Human papillomavirus infection
    103230577 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    103230577 (FASLG)
   05143 African trypanosomiasis
    103230577 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103230577 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csab04147]
    103230577 (FASLG)
   04052 Cytokines and growth factors [BR:csab04052]
    103230577 (FASLG)
   04090 CD molecules [BR:csab04090]
    103230577 (FASLG)
Exosome [BR:csab04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   103230577 (FASLG)
Cytokines and growth factors [BR:csab04052]
 Cytokines
  Tumor necrosis fators
   103230577 (FASLG)
CD molecules [BR:csab04090]
 Proteins
  103230577 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 103230577
NCBI-ProteinID: XP_007987680
Ensembl: ENSCSAG00000011699
UniProt: A0A0D9RGY9
Position
25
AA seq 282 aa AA seqDB search
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPPPLPPPP
PPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTS
QRHTVSSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKG
GLVINETGLYFVYSKVYFRGQSCTNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMW
AHSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcccttcaattacccatatccccagatctactgggtggacagcagtgccagc
tctccctgggcccctccaggcacagttcttccctgtccaacctctgtgcccagaaggcct
ggtcaaaggaggccaccacctccgccgccgccgccgccacctccactaccacctccaccg
ccgccaccactgcctccactaccgctgccacccttgaagaagaggggaaaccacagcaca
ggcctgtgtctccttgtgatgtttttcatggttctggttgccttggtaggattgggactg
gggatgtttcagctcttccacctacagaaagagctggcagaactccgagagtctaccagc
cagaggcatacagtatcatctttggagaaacaaataggtcaccccagtccaccccctgag
aaaaaggagcagaggaaagtggcccatttaacaggcaagcccaactcaaggtccatgcct
ctggaatgggaagacacctatggaattgtcctgctttctggagtgaaatataagaagggt
ggccttgtgatcaatgaaactgggctgtactttgtatattccaaagtatacttccggggt
caatcttgcaccaacctgcccctgagccacaaggtctacatgaggaactctaagtatccc
caggatctggtgatgatggaggggaagatgatgagctactgcactactgggcagatgtgg
gcccacagcagctacctgggggcagtgttcaatcttaccagtgctgatcatttatatgtc
aatgtatctgagctctctctggtcaattttgaggaatctcagacattttttggcctatat
aagctctaa

DBGET integrated database retrieval system