KEGG   Chlorocebus sabaeus (green monkey): 103231049
Entry
103231049         CDS       T04361                                 

Gene name
TM7SF2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00100  Steroid biosynthesis
csab01100  Metabolic pathways
Module
csab_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    103231049 (TM7SF2)
Enzymes [BR:csab01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     103231049 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 103231049
NCBI-ProteinID: XP_007988387
Ensembl: ENSCSAG00000007642
Position
1
AA seq 482 aa
MGRGRVHLKTLGQERSLSALGVQAGAGAAGPDPPRGQVHLLGNGADCVSLTDYCERPLSG
GAETMAPPEGPRAPLEFGGPLGAAVLLLLLPATMFHLLLAARSGPARLLGPPASLPGLEA
LWSPRALLLWLAWLGLQAALYLLPARKVAEGQELKDKSRLRYPINGFQALVLTALLVGLG
VSAGLPLGALPEMLLPLAFVATLTAFIFSLFLYMKAQVAPVSALAPGGISGNPIYDFFLG
RELNPRICFFDFKYFCELRPGLIGWVLINLALLVKEAELRGSPSLAMWLVNGFQLLYVGD
ALWHEEAILTTMDITHDGFGFMLAFGDIAWVPFTYSLQAQFLLRHPQPLGLPMASAICLI
NAIGYYIFRGANSQKNTFRKNPSDPRVAGLETISTATGRKLLVSGWWGMVRHPNYLGDLI
MALAWSLPCGVSHLLPYFYLLYFTALLVHREARDERQCLQKYGLAWQEYCRRVPYRIVPY
IY
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgggcagggggcgggtccatttaaaaaccctgggacaagagcggtccttgtctgcactc
ggtgtccaggcaggtgcaggcgccgcggggccggatcctccgcgcggacaagtccatctc
ctgggaaatggggcggactgtgtttccttgaccgactattgtgagcgccctctctccggc
ggagcggagaccatggcccctcctgagggcccccgggccccgctggaattcggagggccc
ctgggcgccgcggttctgctgctgctgctgcccgccaccatgttccacctgctcctggcg
gcccgttcgggccccgcgcgcctgctgggtccacccgcgtccctgcctgggctggaggcg
ctgtggagcccacgggcgctgctgctgtggctcgcctggctcggcctgcaggcggcgctc
tacctactgccggcgcgcaaggtggctgaggggcaggaattgaaggacaagagtcgcctg
cgctatcccattaacggcttccaggccctggtgctgacagccctgttggtggggctgggg
gtgtcagcagggctgcctctgggggcgctcccggaaatgctcctgcccttggcttttgtc
gccaccctcaccgctttcatcttcagcctctttctctacatgaaggcgcaggtagcccca
gtttcggccttggcacctggggggatctcaggcaatccgatttacgacttttttctggga
cgggagctcaaccctcgaatctgtttctttgacttcaaatatttctgtgaactgcgacct
ggcctcatcggctgggtcctcatcaacctggccctgttggtgaaggaggcagaacttcgg
ggcagtccctcactggccatgtggctggtcaatggcttccagttactctatgtgggtgat
gccctctggcatgaggaggccatcctcaccaccatggatatcacacatgacgggtttggc
ttcatgctggcatttggggacatagcctgggtgcccttcacctacagcctgcaagcccag
ttcctgctgcgccacccgcagcccctggggttgcccatggcttccgccatctgcctcatc
aatgctattggttactacatcttccgtggggcgaattcccagaaaaacactttccgaaag
aatccttctgaccccagagtggctgggcttgagaccatctctacagccacagggcggaaa
ctgctggtgtctgggtggtggggtatggtccgccatcccaactaccttggagacctcatc
atggctctggcttggtccttgccctgcggggtgtcacacctgctgccctacttctacctc
ctctacttcaccgcgctgctggtgcaccgtgaggcccgggatgagcggcagtgcctgcag
aagtacggcctggcctggcaggagtactgccggcgtgtgccttaccgcatcgtgccctac
atctactga

DBGET integrated database retrieval system