KEGG   Chlorocebus sabaeus (green monkey): 103235462
Entry
103235462         CDS       T04361                                 

Gene name
CHMP2A
Definition
(RefSeq) charged multivesicular body protein 2A
  KO
K12191  charged multivesicular body protein 2A
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04144  Endocytosis
csab04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:csab00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103235462 (CHMP2A)
  09143 Cell growth and death
   04217 Necroptosis
    103235462 (CHMP2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csab04131]
    103235462 (CHMP2A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csab04147]
    103235462 (CHMP2A)
Membrane trafficking [BR:csab04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    103235462 (CHMP2A)
Exosome [BR:csab04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103235462 (CHMP2A)
  Exosomal proteins of other body fluids (saliva and urine)
   103235462 (CHMP2A)
  Exosomal proteins of colorectal cancer cells
   103235462 (CHMP2A)
SSDB
Motif
Pfam: Snf7
Other DBs
NCBI-GeneID: 103235462
NCBI-ProteinID: XP_007996652
Ensembl: ENSCSAG00000001588
UniProt: A0A0D9S6F1
Position
6
AA seq 222 aa
MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVR
IMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLP
QIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELS
NLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD
NT seq 669 nt   +upstreamnt  +downstreamnt
atggacctgttgttcgggcgccggaagacgccagaggagctactgcggcagaaccagagg
gccctgaaccgtgccatgcgggagctggaccgcgagcgacagaaactagagacccaggag
aagaaaatcattgcagacattaagaagatggccaagcaaggccagatggatgccgttcgc
atcatggcaaaagacttggtgcgcacccggcgctatgtgcgcaagtttgtattgatgcgg
gccaacatccaggctgtgtccctcaagattcagacactcaagtccaacaactcgatggca
caagccatgaagggtgtcaccaaggccatgggcaccatgaacagacagctgaagttgccc
cagatccagaagatcatgatggagtttgaacggcaggcagagatcatggatatgaaggag
gagatgatgaatgatgctattgatgatgccatgggtgatgaggaagacgaagaggagagt
gatgctgttgtgtcccaggtcctggatgagctgggacttagcctaacagatgagctgtca
aacctcccctcaactggaggctcgctcagtgtggctgctggtgggaaaaaagcagaggcc
gcagcctcagccctagctgatgcggatgcagacctggaggaacggctcaagaacctgcgg
agggactga

DBGET integrated database retrieval system