KEGG   Chlorocebus sabaeus (green monkey): 103235762
Entry
103235762         CDS       T04361                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00230  Purine metabolism
csab00240  Pyrimidine metabolism
csab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103235762 (DCK)
   00240 Pyrimidine metabolism
    103235762 (DCK)
Enzymes [BR:csab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     103235762 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_33 AAA_28
Other DBs
NCBI-GeneID: 103235762
NCBI-ProteinID: XP_007997023
Ensembl: ENSCSAG00000004847
UniProt: A0A0D9QXT7
Position
7
AA seq 260 aa
MATPPKRSCPSLSASSEGTRIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCN
VQSTQDESEELTTSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAE
KPVLLFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
TPEKCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTDFDYLQEVPILIMDVNE
DFKDKHENLVEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccgcccaagagaagctgcccgtctctctcagccagctctgaggggacccgc
atcaagaaaatctccatcgaagggaacatcgctgcagggaagtcaacatttgtgaatatc
cttaaacaagtatgtgaagattgggaagtggttcctgaacctgttgccagatggtgcaat
gttcaaagtactcaagatgaatctgaggaacttacaacgtctcagaaaaatggtgggaat
gttcttcagatgatgtatgagaaacctgaacgatggtcatttaccttccaaacatatgcc
tgtctcagtcgaataagagctcagcttgcctctctcaatggcaagctcaaagatgcagag
aaacctgtattactttttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgaatgcatgaatgaaacagagtggacaatttatcaagactggcatgac
tggatgaataaccagtttggccaaagccttgaattggatggaatcatttatcttcgagcc
actccagagaaatgcttacatagaatatatttacggggaagaaatgaagagcaaggcatt
cctcttgaatatttagagaagcttcattataaacacgaaagctggctcctgcataggaca
ctgaaaaccgacttcgattatcttcaagaggtgcctatcttaataatggatgttaatgaa
gactttaaagacaaacatgaaaatctggttgaaaaggtcaaagaatttttgagtactttg
tga

DBGET integrated database retrieval system