KEGG   Chlorocebus sabaeus (green monkey): 103237814Help
Entry
103237814         CDS       T04361                                 

Definition
(RefSeq) aldo-keto reductase family 1 member C4
  KO
K00037  3alpha-hydroxysteroid 3-dehydrogenase / chlordecone reductase [EC:1.1.1.50 1.1.1.357 1.1.1.225]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00120  Primary bile acid biosynthesis
csab00140  Steroid hormone biosynthesis
csab01100  Metabolic pathways
Module
csab_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    103237814
   00140 Steroid hormone biosynthesis
    103237814
Enzymes [BR:csab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.50  3alpha-hydroxysteroid 3-dehydrogenase (Si-specific)
     103237814
    1.1.1.225  chlordecone reductase
     103237814
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     103237814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 103237814
NCBI-ProteinID: XP_008000331
Ensembl: ENSCSAG00000013867
UniProt: A0A0D9RN27
Position
9
AA seq 323 aa AA seqDB search
MDPKYQRVALNDGHFMPVLGFGSYAPPEVPRNRVVEVTKLAIEAGFRHIDSAYLYNNEEQ
VGLAIRSKIADGSVKREDIFCTSKLWCTFFRPQLVQPALESSLKKLQLDYVDLYLIHFPM
ALKPDETPLPKDENGKVMFDTVDLCAIWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYLNQRKLLDFCKSKDIVLVAHSALGTQRHKLWVDQNSPVLLEDPV
LCALAKKHKRSPALIALRYQLQRGVVVLAKSYNEQRIRENVQVFEFQLTSEDMKVIDDLN
RNFRYVVMDFLVDHPDYPFSDEY
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggatcccaaatatcagcgtgtggcgctaaatgatggtcacttcatgcccgtattggga
tttggctcctatgcacctccagaggttccgaggaacagagttgtggaggtcaccaaatta
gcaatagaagctggcttccgccatattgattctgcttatttatacaacaatgaggaacaa
gttggactggccatccgaagcaagattgcagacggcagtgtgaagagagaagacatattc
tgcacttcaaagctttggtgcactttctttcgaccacagttggtccaaccagccttggaa
agctcactgaaaaaacttcaactggactatgtggacctctatcttattcatttcccaatg
gctctcaagccagatgagacgccactaccaaaagatgaaaatggaaaagtaatgttcgac
acagtggatctctgtgccatatgggaggccatggagaagtgtaaggatgcaggattagcc
aagtccattggggtgtcaaacttcaaccgcaggcagctggagatgatcctcaacaagcca
ggactcaagtacaagcccgtctgcaaccaggtggaatgtcatccttacctcaaccagaga
aaactgctggatttctgcaagtccaaagacattgtcctggttgcccatagtgctctggga
acccaacgacataaactatgggtggaccagaactccccagttcttttggaggacccagtt
ctttgcgccttagcaaagaaacacaaacgatccccagccctgattgccctgcgctaccag
ctgcagcgtggggttgtggtcctggccaagagctacaatgagcagcggatcagagaaaat
gtccaggtttttgaattccagttgacttcggaggatatgaaagttatagatgacctaaac
agaaattttcgatatgttgtcatggattttcttgtggaccaccctgattatccattttca
gatgaatattag

DBGET integrated database retrieval system