KEGG   Chlorocebus sabaeus (green monkey): 103238293
Entry
103238293         CDS       T04361                                 

Gene name
ASIC1
Definition
(RefSeq) acid sensing ion channel subunit 1
  KO
K04829  acid-sensing ion channel 1
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:csab00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103238293 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:csab04040]
    103238293 (ASIC1)
Ion channels [BR:csab04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   103238293 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 103238293
NCBI-ProteinID: XP_008001392
Ensembl: ENSCSAG00000005996
Position
11
AA seq 529 aa
MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCS
AEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS
FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRQLIYLPPPWGTCKAVTMDSDL
DFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQE
YCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYET
IEQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSS
ADKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1590 nt   +upstreamnt  +downstreamnt
atggaactgaaggccgaggaggaggaggtgggtggcgtccagccggtgagcatccaggcc
ttcgccagcagctccacgctgcacggcctggcccacatcttctcctacgagcggctgtct
ctgaagcgggcattgtgggccctgtgcttcctgggctcgctggctgtgctgctgtgtgtg
tgcacggagcgtgtgcagtactacttccactaccaccatgtcaccaagctcgacgaggtg
gctgcctctcagcttactttccctgctgtcacactgtgcaacctcaacgagttccgcttt
agccaagtctccaagaatgacctgtatcatgccggggagcttctggccctgctcaacaac
aggtatgagataccagacacacagatggcagatgaaaagcagctggagatattgcaggac
aaagccaacttccgcagcttcaaacccaaacccttcaacatgcgtgagttctatgaccga
gctgggcacgacattcgagacatgctgctctcctgccacttccggggagaggtctgcagc
gctgaagacttcaaggtggtcttcacacgctatggaaagtgctacacgttcaactcaggc
cgagatgggcggccgcggctgaagaccatgaagggtgggacaggcaatgggctggaaatc
atgctggacatccagcaggacgagtacctgcctgtgtggggggagactgacgagacgtcc
ttcgaagcaggcatcaaagtgcagatccatagtcaggatgaacctcctttcatcgaccag
ctgggctttggcgtggccccaggcttccagacctttgtggcctgccaggagcagcggcag
ctcatctacctgcccccgccctggggcacctgcaaagctgttaccatggactcggatttg
gatttcttcgactcctacagcatcaccgcctgccgcatcgactgtgagacgcgctacctg
gtggagaactgcaactgccgcatggtgcacatgccaggggatgccccatactgtactcca
gagcagtacaaggagtgtgcagatcctgctctggacttcctggtggagaaggaccaggag
tactgcgtgtgtgaaatgccttgcaacctgacccgctatggcaaggagctgtccatggtc
aagatccccagcaaagcctcagccaagtacctggccaagaagttcaacaaatctgagcaa
tacataggggagaacatcctggtgctggacattttctttgaagtcctcaactatgagacc
attgaacagaagaaggcctatgagattgcagggctcctgggtgacatcgggggccagatg
gggctgttcatcggcgccagcatcctcacggtgctggagctctttgactacgcctacgag
gtcattaagcacaagctgtgccgacgaggaaagtgccagaaggaggccaaaaggagcagt
gcggacaagggcgtggccctcagcctggacgacgtcaaaagacacaacccgtgcgagagc
ctccggggccaccctgccgggatgacatacgctgccaacatcctacctcaccatccggcc
cgaggcacgttcgaggactttacctgctga

DBGET integrated database retrieval system