KEGG   Chlorocebus sabaeus (green monkey): 103238388Help
Entry
103238388         CDS       T04361                                 

Definition
(RefSeq) separin-like
  KO
K02365  separase [EC:3.4.22.49]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04110  Cell cycle
csab04114  Oocyte meiosis
csab05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:csab00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103238388
   04114 Oocyte meiosis
    103238388
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103238388
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:csab01002]
    103238388
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csab03036]
    103238388
Enzymes [BR:csab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     103238388
Peptidases and inhibitors [BR:csab01002]
 Cysteine peptidases
  Family C50: separase family
   103238388
Chromosome and associated proteins [BR:csab03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    103238388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 103238388
NCBI-ProteinID: XP_008001598
Position
11
AA seq 292 aa AA seqDB search
MKMVLTTTVPLQIMLSGASALTPQDVQALAYGLCPTQPERAQELLNEAVGHLQGLTVPSN
SHLVLVLDKDLQKLPWESMPSLQALPVTRLPSFRFLLSYSIIKEYGASPVLSQGVDPRST
FYVLNPHNNLSSTEEQFRANFSSEAGWRGVVGEVPRPEQVQEALTKHDLYIYAGHGAGAR
FLDGQAVLRLSCRAVALLFGCSSAALAVHGNLEGAGIVLKYIMAGCPLFLGNLWDVTDRD
IDRYTEALLQGWLGAGPGAPLLYYVNQARQAPRLKYLIGAAPIAYGLPVSLR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggtgctcaccaccactgttcccctgcagatcatgctcagtggtgccagtgcc
ctcacccctcaggacgttcaggccctggcctacgggctgtgcccaacccagccagagcga
gcccaggagctcctgaatgaggcagtaggacacctacagggcctgacagtaccaagcaat
agccaccttgtcttggtcctggacaaggacttgcagaagctgccgtgggaaagcatgccc
agcctccaggcactgcctgtcacccggctgccctccttccgcttcctactcagctactcc
atcatcaaagagtatggggcctcgccagtgctgagtcaaggggtggatccgcgaagtacc
ttctacgtcctgaaccctcacaataacctgtcaagcacagaggagcaatttcgagccaat
ttcagcagtgaagctggctggagaggagtggttggggaggtgccgagacccgaacaggtg
caggaagccctgacaaagcatgatttgtatatctatgcagggcatggggctggtgcccgc
ttccttgacgggcaggctgtcctgcggctgagctgccgggcagtggccctgctgtttggc
tgtagcagtgcggccctggctgtgcatggaaacctggagggggctggcatcgtgctcaag
tacatcatggctggttgccccttgtttctgggtaatctctgggatgtgactgatcgtgat
attgaccgctacacggaagctctgctgcagggctggcttggagcaggcccgggggccccc
cttctgtactatgtaaaccaggcccgccaagctccccgactcaagtatcttattggggct
gcacctatagcctatggcttgcctgtctctctgcggtaa

DBGET integrated database retrieval system