KEGG   Chlorocebus sabaeus (green monkey): 103238482
Entry
103238482         CDS       T04361                                 

Gene name
RDH5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    103238482 (RDH5)
Enzymes [BR:csab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     103238482 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 103238482
NCBI-ProteinID: XP_008001756
Ensembl: ENSCSAG00000005320
UniProt: A0A0D9QZ40
Position
11
AA seq 318 aa
MWLPLLLGALLWAVLWLLRDRQSLPASDAFVFITGCDSGFGRLLALQLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDITDPQSVQQAAKWVETHVKEAGLFGLVNNAGVAGIIGP
TPWLTRDDFQRVLNVNTMGPIGVTLALLPLLQQARGRVINITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAHFGIRVSIVEPGFFRTPVTNLESLEKTLQACWARLPPATQAHYGGA
FLTKYLKMQQRIMNLICDPDLTKVSKCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWILPKPAQAVC
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgctgctgggtgccttactctgggcagtgctgtggttgctcagggac
cggcagagcctgcccgccagcgatgcctttgtcttcatcaccggctgtgactcaggcttt
gggcgccttctggcactgcagctggaccagagaggcttccgagtcctggccagctgcctg
actccctctggggccgaggacctgcagcgggtggcctcctcccgcctccacactaccctg
ctggatatcactgatccccagagcgtccagcaggcagccaagtgggtggagacgcacgtt
aaggaagcagggctttttggtctggtgaataatgctggtgtggctggtatcatcggaccc
acaccatggctgacccgggatgatttccagcgggtgctgaatgtgaacacaatgggtccc
atcggggtcacccttgccctgctacctctgctgcagcaagcccggggccgggtgatcaac
atcaccagcgtcctgggtcgcctggcagccaatggtgggggctactgtgtctccaaattt
ggcctggaggccttctctgacagtctgaggcgggatgtggctcattttgggatacgagtc
tccatcgtggagcctggcttcttccgaacccctgtgaccaacctggagagtctggagaaa
accctgcaggcctgttgggcacggctacctcctgccacacaggcccactatgggggggcc
ttcctcaccaagtacctgaaaatgcaacagcgcatcatgaacctcatctgtgacccggac
ctaaccaaggtgagcaaatgcctggagcatgccctgactgctcgacacccccgaacccgc
tacagcccaggctgggatgccaagctgctctggctgcctgcctcctacctgccagccagc
ctggtggatgctgtgctcacctggatccttcccaagcctgcccaagcagtctgttga

DBGET integrated database retrieval system