KEGG   Chlorocebus sabaeus (green monkey): 103239134Help
Entry
103239134         CDS       T04361                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00010  Glycolysis / Gluconeogenesis
csab00053  Ascorbate and aldarate metabolism
csab00071  Fatty acid degradation
csab00280  Valine, leucine and isoleucine degradation
csab00310  Lysine degradation
csab00330  Arginine and proline metabolism
csab00340  Histidine metabolism
csab00380  Tryptophan metabolism
csab00410  beta-Alanine metabolism
csab00561  Glycerolipid metabolism
csab00620  Pyruvate metabolism
csab01100  Metabolic pathways
Module
csab_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103239134 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    103239134 (ALDH2)
   00620 Pyruvate metabolism
    103239134 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103239134 (ALDH2)
   00561 Glycerolipid metabolism
    103239134 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103239134 (ALDH2)
   00310 Lysine degradation
    103239134 (ALDH2)
   00330 Arginine and proline metabolism
    103239134 (ALDH2)
   00340 Histidine metabolism
    103239134 (ALDH2)
   00380 Tryptophan metabolism
    103239134 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103239134 (ALDH2)
Enzymes [BR:csab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103239134 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 103239134
NCBI-ProteinID: XP_008002939
Ensembl: ENSCSAG00000002555
Position
11
AA seq 557 aa AA seqDB search
MLRAAARFGPRLGLRFLSAAATQAVPAPNQQPEVFCNKDFSSQKPGLGCWTSSAGVARAV
SESLWNAWVNESQLLQNKIFINNEWHNAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAV
KAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVTSYLVDLD
MVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPAL
ATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAF
TGSTEIGRLIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCC
AGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQE
GAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS
TYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQ
AYTEVKTITVKVPQKNS
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtgctgccgcccgcttcgggccccgcctgggcctccgcttcttgtcagccgcc
gccacccaggccgtgcccgcccccaaccagcagcccgaggtcttctgcaacaaggacttc
agctcccagaagccgggacttggctgttggacttccagtgctggagtggccagggctgtc
agtgaaagcttatggaacgcgtgggtgaatgaatcccaacttttacaaaacaaaatcttc
ataaacaatgaatggcacaatgccgtcagcaggaaaacattccccacggtcaatccgtcc
actggagaggtcatctgccaggtagctgaaggagacaaggaagatgtggacaaggcagtg
aaggccgcccgggccgccttccagctgggctcaccttggcgtcgcatggacgcatcacac
aggggccggctgctgaaccggctggctgatctgatcgagcgggaccggacctacctggcg
gccttggagactctggacaatggcaaaccctatgtcacctcctacctggtggatttggac
atggtcctcaaatgtctccggtattatgccggctgggctgataagtaccacgggaaaacc
attcccattgatggagacttcttcagctacacccgccatgaacctgtgggggtgtgcggg
cagatcattccgtggaatttcccgctcctgatgcaagcatggaagctgggcccagccttg
gcgactggaaacgtggttgtgatgaaggtagctgagcagacgcccctcactgccctctat
gtggccaacctgatcaaggaggccggctttcccccgggtgtggtcaacattgttcctgga
tttggccccacggccggggctgccatcgcctcccatgaggatgtggacaaagtggcattc
acaggctccaccgagattggccgcctcatccaggttgctgccgggagcagcaatctcaag
agagtgaccttggagctggggggaaagagccccaacatcatcatgtcagatgccgacatg
gactgggccgtggagcaggcccactttgccctgttcttcaaccagggccagtgctgctgt
gctggctcccggaccttcgtgcaggaggacatctatgacgagtttgtggagcggagcgtt
gcccgggccaagtctcgggtggtcgggaacccctttgacagcaagaccgagcaggggccg
caggtggatgaaactcagtttaagaagatcctcggctacatcaacactgggaagcaagag
ggggcgaagctgctgtgtggtgggggcattgctgctgaccgtggttacttcatccagccc
accgtgtttggagatgtgcaggatggcatgaccatcgccaaggaggagatcttcgggcca
gtgatgcagatcctgaagttcaagaccatagaggaagttgttgggagagccaacaattcc
acgtacgggttggccgcagctgtcttcacaaaggatttggacaaggccaattacctgtcc
caggccctccaggcgggcaccgtgtgggtcaactgctatgatgtgtttggagcccagtca
ccctttggtggctacaagatgtcgggcagtggccgggagctgggcgagtacggcctgcag
gcatacactgaagtgaaaactatcacagtcaaagtgcctcagaagaactcataa

DBGET integrated database retrieval system