KEGG   Chlorocebus sabaeus (green monkey): 103240251Help
Entry
103240251         CDS       T04361                                 

Gene name
MRVI1
Definition
(RefSeq) murine retrovirus integration site 1 homolog
  KO
K12337  inositol 1,4,5-triphosphate receptor-associated cGMP kinase substrate
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04022  cGMP-PKG signaling pathway
csab04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    103240251 (MRVI1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103240251 (MRVI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRVI1
Motif
Other DBs
NCBI-GeneID: 103240251
NCBI-ProteinID: XP_008004995
Ensembl: ENSCSAG00000004576
Position
1
AA seq 914 aa AA seqDB search
MVKAPQSEGRLARGGKENNSVLACGAQASWSIFGADAAEVPGTRGHSQQEAAMPHIPEDE
EPPGEPQAAQSPAGQQGPPTTGISHSPPPTIVLTGDATSPEGETDKNLANRVHSPHKRPS
HRHLKVSTASLTSVDPTGHIIDLVNDQLPDISISEEDKKKNLALLEEAKLVSERFLTRRG
RKSRSSPGDSPSAVSPNLSPSASPTSSRSNSLTVPTPPGLDVCSGPPSPLPGAPPQQKGD
EADISSPHPGEPNVPKGLADRKQNDQRKVSQGRLAPRPPPVEKSKEIAIEQKENFDPLQY
RETTPKGLAPVTNSSGKMALNSPQSGPVESELGKQLLKTAWEGSPLPRSPTQDAGGVAPP
APQGRSPAGEPMGPKAGSKAELPPTVSRPPLLRGLSWDSGPEEPGPRLQKVLAKLPLAEE
EKRFAGKAGGKLAKAPGLKDFQIQVQPVRMQKLTKLREEHILMRNQNLVGLKLPDLSEAN
EQEKGLSSELSPAIEEEESKSGLDVMPNISDVLLRKLRVHKSLPGSAPPLTEKEVENVFV
QLSLAFRNDSYTLESRINQAERERNLTEENTEKELENFKASITSSASLWHHCEHRETYQK
LLEDITVLHRLAARLSSRAEVVGAVRQEKRMSKATEVMMQYVENLKRTYEKDHAELMEFK
KLANQNSSRSCGPSEDGVPRTARSMSLTLGKNMPRRRVSVAVVPKFNALNLPGQTPSSSP
IPSLPALSESPNGKGSLPVTSALPALLENGKTNGDPDCEACAPALALSCLEELSQETKAR
MQEEAYSKGFQEGLKKTKELQDLKEEEEEQKSESPEEPEEVEETEEEEKGPRSSKFEELV
HFLQVMYPKLCQHWQVIWMMAAVMLVLTVVLGLYNSYNSCAEQADGPLGRSTCSAAQRDS
WWSSGLQHEQPTEQ
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagctccccagagtgaagggaggctggccagaggaggaaaggagaataactca
gttttagcctgtggagcccaggcctcttggagcatctttggggctgacgcagcggaggtt
ccgggcacacgtggccactcccagcaggaggctgccatgccccacattcccgaggacgag
gagccccccggagagccacaggcagcccagagccctgccggccaacagggtcctcctacc
acaggaatatctcacagtccaccccccacgattgtcctgactggggatgccacttcacca
gaaggagaaaccgacaaaaacctggccaacagagttcacagtccccacaagaggccttct
caccgacacttgaaggtgtccactgcctccctgacatctgtggaccccacggggcacatc
attgacctggtgaatgaccagctgccagatatcagcatctcagaggaggacaagaagaaa
aacctggcgctgctggaagaagccaagttagtgagtgagcgattcctgacccgccgtggg
aggaagtccaggagcagccccggagactccccatcagctgtttccccaaacctcagcccc
agcgcttctcctacatcctctcgaagcaactcgcttacagtccccaccccgccaggtttg
gatgtgtgcagtggtccgccatcccctctgcctggagcgccaccacagcagaagggggat
gaggccgacatctcttcacctcaccctggcgagcctaatgtccccaaagggctagctgac
aggaagcagaatgaccagaggaaagtgtctcagggcaggctggctcctcgtcctcctcca
gttgagaagtccaaagagattgcaatagaacaaaaggaaaactttgatcccctccagtac
cgggagaccacacccaaaggcctagctcctgtcacaaacagcagtgggaaaatggccctg
aacagccctcagtctggccccgtggagagcgagctggggaagcagctcttgaaaacagcc
tgggagggcagccctctgccgagaagtccaacccaggatgcgggaggagtggctccccca
gccccccaggggagaagcccagctggagagccgatggggcccaaggctggctccaaagct
gagcttccacccactgtgtcccgcccccccctgctgcgagggctctcctgggacagtgga
cctgaagaacctggcccccggctgcagaaagtgcttgccaagctgccactggcagaggaa
gaaaaacgttttgcaggcaaagccggtggcaagctggccaaggcccctggactcaaagac
tttcagatacaagtgcagcccgtgcggatgcagaaactgaccaagctccgagaggagcac
atcctgatgagaaatcagaacttagtggggctcaagcttccagaccttagtgaagcgaat
gagcaggaaaaagggctttcttctgaactctccccagctattgaggaagaagagtcaaag
agtggcctagatgtcatgcctaatatttctgatgtgctgctgcgcaaactgcgggtccac
aagagtctccctggaagtgcccctccactcactgaaaaggaagttgagaacgtgtttgta
caactgtccttggcctttagaaatgacagctacactctggaatctagaattaaccaggct
gaaagggaacgcaacctgacagaggagaacactgagaaggaactggaaaacttcaaagct
tccattacgtcctcagcttcactctggcaccactgtgagcaccgggagacctaccagaag
ttgctggaggacatcactgtcctgcaccgcctggctgcccgcctctccagtcgagctgag
gtggtgggtgccgtccgccaggaaaagcgcatgtcgaaagcaacagaagtgatgatgcag
tatgtggagaatctaaagaggacatatgagaaggaccatgcggagctcatggagtttaaa
aaacttgcaaatcagaattcaagccgcagctgtggcccctctgaagatggggtccctcgc
acggcgcggtccatgtccctcacgctgggaaagaatatgcctcgccggagggtcagcgtt
gccgttgttcctaagtttaatgccctgaatctgcctggccaaactcccagttcatcaccc
atcccctccttaccagccttgtcggaatcacccaatgggaaaggcagcctacctgtcact
tcagcactgcctgcacttttggaaaatggaaagacaaatggggacccagattgtgaagcc
tgtgctcctgcactggccctgagctgcctggaggagcttagtcaggagaccaaggccagg
atgcaggaagaagcctacagcaagggattccaagaaggtctaaagaagaccaaagaactt
caagacctgaaggaggaggaggaagaacagaagagtgagagtcctgaggaacctgaagag
gtagaagaaactgaggaagaggaaaagggcccaagaagcagcaaatttgaagaattggtc
catttcttacaagtcatgtatcccaaactgtgtcagcactggcaagtgatctggatgatg
gctgcagtgatgctggtcttgactgttgtgctggggctctacaattcctataactcttgt
gcagagcaggctgatgggccccttggaagatccacttgctctgcagcccagagggactcc
tggtggagctcaggactccagcatgagcagcctacagagcagtag

DBGET integrated database retrieval system