KEGG   Chlorocebus sabaeus (green monkey): 103241116
Entry
103241116         CDS       T04361                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
csab  Chlorocebus sabaeus (green monkey)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:csab03021]
    103241116 (AFF3)
Transcription machinery [BR:csab03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     103241116 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 103241116
NCBI-ProteinID: XP_008006367
Ensembl: ENSCSAG00000017193
Position
14
AA seq 1208 aa
MDSFDLALLQEWDLESLCVYEPDRNALRRKERERRNQETQQDDGTFNSSYSLFSEPYKTN
KGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGVPKPGVPQTPVNKIDEHFVADSRAQT
QPSSIGSTTTSTPAAVPVQQTKRGTMGWQKAGHPPSDGQQRATQQGSLRTLLGDGVGRQQ
PRAKQVCNVEVGLQTQERPPAMAAKHSSSGHCVQNFPPSLASKPSLVQQKPTAYVRPMDG
QDQAPDESPKLKSSSETSVHCTSYRGVPASKPEPARAKAKLSKFSIPKQVEESRSGETNS
CVEEIIREMTWLPPLSAIQAPGKVEPTKFPFPNKDSQLVSSGHNNPKKGDAEPESPDNGT
SNTSMLEDDLKLSSDEEENEQAAQRTALRTLSDSTVVQQPNCRTSVPSSKGSSSSSSSGS
SSSSSDSESSSGSDSETESSSSESEGSKPPHFSSPEAEPASSNKWQLDKWLNKVNPHKPI
LIQNESHGPESNQYYNPVKEDVQDCGKVPDVCQPSLREKEVKSTCKEEQRPRTANKAPGS
KGVKQKSPPAAVAVAVSAAAPPPAVPCAPAENAPAPARRSAGKKPTRRTERTSAGDGANL
HRPEEPAAPDALGTSVVVPPEPTKTRPCGNNRASHRKELRSSVTCEKRRTRGLSRIVPKS
KEFIETESSSSSSSSDSDLESEQEEYPLSKAQTVAASASSGNDQRLKEAAANGGNGPRAP
VGSINARTTSDIAKELEEQFYTLVPFGRNELLSPLKDSDEVRSLWVKIDLTLLSRIPEHL
PQEPGVLSAPATKDSESAPPSHTSDTPAEKALPKSKRKRKCDNEDDYRDIKKAQGEKDSS
SRLATSTGNTLSANHCNMNINSVAIPINKNEKMLRSPISPLSDASKHKYTSEDLTSSSRP
NGNSLFTSASSSKKPKADSQLQPHGGDLTKAAHNNSENIPLHKSRPQTEPWSPGSNSHRD
CKRQKLVFDDMPRSADYFMQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGP
MESKSPYTMYSETVELIRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFRLKRDH
AVKYSKALIDYFKNSSKAAQAPSPWGASGNSVGSQGSLSNPSALSPSTIVSIPQRIHQMA
ANHVSITNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHW
LRNSAHLS
NT seq 3627 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagccctgctccaggaatgggacctcgagtcgctgtgtgtctat
gaaccagatagaaatgcattacggaggaaagaacgagaaagaagaaatcaagaaactcaa
caggatgacggcacgtttaattctagttactctctcttcagtgagccctacaagactaac
aagggggatgaactgtccaaccggatccagaacactttaggcaattatgatgaaatgaaa
gactttttaactgatagatccaatcagagtcatctcgttggagttcccaaaccaggggtt
cctcagactcctgtgaacaagatcgatgaacattttgttgcagattcaagagcccagacc
cagccctcatctatcggtagcactacaacttccacaccagcagctgtccccgtgcagcag
actaagagaggcactatgggctggcagaaggctgggcacccaccctccgacggccaacag
agagcaacacaacagggctctctcaggaccttgcttggagatggtgttggcagacagcag
ccgcgggccaaacaagtgtgcaatgtggaggtgggccttcagacccaggagagaccacct
gccatggcggccaagcacagcagcagcggacactgtgttcagaactttcctccatcccta
gcttcaaaacccagcctggtccagcagaaaccgaccgcgtacgtgcggccgatggacggc
caagatcaggcccctgatgagtctcctaagctgaagtcgtcttcggaaaccagcgtgcac
tgcacatcatacagaggagtccccgccagcaagccggagccggccagagccaaggccaag
ctctccaagttcagcatccccaagcaggtggaggagagtagatctggagaaaccaacagc
tgtgttgaagaaataatccgggagatgacctggcttccaccactttctgctattcaagca
cctggcaaagtggaaccaaccaaatttccatttccaaataaggactctcagcttgtatcc
tctggacacaataatccaaagaaaggtgatgcagagccagagagtccagacaatggcaca
tcgaatacatcaatgctggaagatgaccttaagctaagcagtgatgaagaggagaatgaa
caggcagctcagagaacggctctccgcactctgtctgacagcaccgtggtccagcagccc
aactgcagaacctcagtgccttccagtaaaggcagcagcagcagcagcagcagcggcagc
agcagctcctccagcgactcagagagcagctcaggatctgactcggagaccgagagcagc
tccagcgagagtgagggcagcaagcccccccacttctccagccccgaggctgaaccggca
tcctccaacaagtggcagctggataaatggctgaacaaagttaatccccacaaacctatt
ctgatccaaaacgaaagccacgggccagagagcaatcagtactacaacccggtgaaagag
gacgtccaggactgtgggaaagtccccgacgtttgccagcccagcctgagggagaaggag
gtcaagagcacctgcaaggaggagcagaggccgaggacagccaacaaggccccggggagt
aaaggcgtgaagcagaagtccccgcccgcggccgtggccgtggctgtgagcgcagccgcc
ccgccgcccgcagtgccctgtgcgcccgcggagaacgcacccgcgcccgcccggaggtcg
gcgggcaagaagcccaccaggcgcacggagaggacctcagccggggacggcgccaacctc
caccggcccgaggagcccgcggccccggacgcactggggacaagcgtggtggtccccccg
gagcccaccaaaaccaggccctgtggcaacaacagagcgagccaccgcaaggagctgcgc
tcctccgtgacctgcgagaagcgccgcacgcgggggctgagcaggatcgtccccaaatcc
aaggagttcattgagacagagtcgtcatcgtcgtcctcctcctcggactccgacctggag
tccgagcaggaggagtaccctctgtccaaagcacagaccgtggctgcctctgcctcctcg
gggaatgatcagaggctgaaggaggccgctgccaacgggggcaatggtcccagggcccct
gtaggctccatcaacgccaggaccaccagtgacatcgccaaggagctggaggagcagttc
tacaccctggtcccctttggccgcaacgaacttctgtcccctctaaaggacagtgatgag
gtcaggtctctctgggtcaaaatcgacctgaccctcctgtccaggatcccagaacacctg
ccgcaggaaccaggggtcttgagcgctcctgccaccaaggactctgagagcgcaccgccc
agccacacctcagacacacctgcagaaaaggctttgccaaaatccaagaggaaacgcaag
tgtgacaacgaagacgactacagggacatcaagaaggcccagggagagaaagacagctct
tcaagactggccacctccaccggtaatactttgtctgcaaaccactgcaacatgaatatc
aacagtgtggcaataccaataaataaaaatgaaaaaatgcttcggtcgcccatctcaccc
ctctccgacgcatctaaacacaaatacaccagcgaggacttaacttcttccagccgacct
aatggcaacagtttgttcacttcagcctcttccagcaaaaagcctaaggccgacagccag
ctgcagcctcacggcggagacctcacgaaagcagctcacaacaattctgaaaacattccc
ctccacaagtcacgaccacagacggagccgtggtctccaggctccaacagccacagggac
tgcaagaggcagaaactcgtcttcgatgatatgcctcgcagtgccgattattttatgcaa
gaagctaaacgaatgaagcataaagcagatgcaatggtggaaaagtttggaaaggctttg
aactatgctgaagcggcgttgtcgtttattgagtgtggaaatgcaatggaacaaggcccc
atggaatccaaatctccttatacgatgtattcagaaacagtagagctcatcaggtatgct
atgagactaaaaacccactcaggccccaacgccacaccagaagacaaacaactggctgca
ttatgttaccgatgcctggctctcctgtactggcggatgtttcgactcaaaagggaccac
gctgtaaagtattcaaaagcactaattgactatttcaagaactcatctaaagccgcccaa
gccccatccccgtggggggccagtggaaactcagtggggtctcagggcagcctctccaac
cccagcgccctgtccccgtcgaccatcgtcagcatcccacagcgcatccaccagatggcg
gccaaccacgtcagcatcaccaacagcatcctgcacagctacgactactgggagatggcc
gacaacctggccaaggaaaaccgagaattcttcaacgacctggatctgctcatggggccg
gtcaccctgcacagcagcatggaacacctggtccagtactcccaacagggcctgcactgg
ctgcggaacagcgcccacctgtcatag

DBGET integrated database retrieval system