KEGG   Chlorocebus sabaeus (green monkey): 103242701
Entry
103242701         CDS       T04361                                 

Gene name
MYO1D
Definition
(RefSeq) myosin ID
  KO
K10356  myosin I
Organism
csab  Chlorocebus sabaeus (green monkey)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:csab01009]
    103242701 (MYO1D)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csab04131]
    103242701 (MYO1D)
   03036 Chromosome and associated proteins [BR:csab03036]
    103242701 (MYO1D)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:csab04812]
    103242701 (MYO1D)
   04147 Exosome [BR:csab04147]
    103242701 (MYO1D)
Protein phosphatases and associated proteins [BR:csab01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103242701 (MYO1D)
Membrane trafficking [BR:csab04131]
 Endocytosis
  Phagocytosis
   Others
    103242701 (MYO1D)
 Others
  Actin-binding proteins
   Myosins
    103242701 (MYO1D)
Chromosome and associated proteins [BR:csab03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    103242701 (MYO1D)
Cytoskeleton proteins [BR:csab04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     103242701 (MYO1D)
Exosome [BR:csab04147]
 Exosomal proteins
  Proteins found in most exosomes
   103242701 (MYO1D)
SSDB
Motif
Pfam: Myosin_head Myosin_TH1 IQ Zeta_toxin AAA_18 AAA_22 Sigma54_activat AAA_16 TsaE
Other DBs
NCBI-GeneID: 103242701
NCBI-ProteinID: XP_008009189
Ensembl: ENSCSAG00000006369
UniProt: A0A0D9R221
Position
16
AA seq 1006 aa
MAEQESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKLLNIYGR
DTIEQYKGRELYERPPHLFAIADAAYKAMKRRSKDTCIVISGESGAGKTEASKYIMQYIA
AITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGH
INNYLLEKSRVIVQQPGERSFHSFYQLLQGGSEQILRSLHLQKSLSSYNYIHVGAQLKCS
INDAAEFKVVADAMKVIGFKPEEIQTVYKILATILHLGNLKFVVDGDTPLIENGKVVSII
AELLSTKTDMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYERLFCWIVTCIN
DIIEVKNYDTTVHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQ
EEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDEMFLEALNSKLG
KHVHFSSRKLCASDKILEFDRDFRIRHYAGDVVYSVIGFIDKNKDTLFQDFKRLMYNSSN
PVLKNMWPEGKLSITEVTKRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNDKKSPQI
FDDERCRHQVEYLGLLENVRVRRAGFAFRQTYEKFLHRYKMISEFTWPNHDLPSDKEAVK
KLIERCGFQDDVAYGKTKIFIRTPRTLFTLEELRAQMLIRIVLFLQKVWRGTLARMRYKR
TKAALTIIRYYRRYKVKSYIHEVARRFHGVKTMRDYGKHVKWPSPPKVLRRFEEALQTIF
NRWRASQLIKSIPASDLPQVRAKVAAMEMLKGQRADLGLQRAWEGNYLASKPDTPQTSGT
FVPVANELKRKDKYMNVLFSCHVRKVNRFSKVEDRAIFVTDRHLYKMDPTKQYKVMKTIP
LYNLTGLSVSNGKDQLVVFHTKDNKDLIVCLFSKQPTHESRIGELVGVLVNHFKSEKRHL
QVNVTNPVQCSLHGKKCTVSVETRLNQPQPDFTKNRSGFILSVPGN
NT seq 3021 nt   +upstreamnt  +downstreamnt
atggcggagcaggagagcctggagttcggcaaggcggacttcgtgctgatggacaccgtc
tccatgcccgagttcatggccaacctcaggctcagatttgaaaaagggcgcatctatacg
ttcattggagaagtcgtcgtttctgtgaacccttacaagttgttgaacatctatggaaga
gacacaattgagcagtataaaggccgtgagctgtatgagagaccgcctcacctttttgct
attgcagatgctgcttacaaggctatgaagaggcgatcaaaagacacttgtattgtgata
tcaggggaaagtggagctggtaaaacggaagccagtaagtacatcatgcagtatattgcg
gccatcaccaaccccagtcagagagcagaggttgaaagagtgaagaatatgttgcttaag
tccaactgtgttttggaagcttttggaaatgccaaaaccaaccgtaatgacaactccagc
aggtttggaaaatacatggatatcaactttgacttcaagggtgaccctattggtgggcat
atcaataactacttactggaaaagtctcgagtgattgtgcaacagccaggagaaagaagc
tttcattctttctatcagctactccaaggaggttcagagcagatactgcgctctctacat
ctccagaaatccctttcatcctacaactatattcatgtgggagctcaattaaagtgttct
atcaatgatgctgccgaattcaaagttgttgctgatgccatgaaagtcattggcttcaaa
cctgaggagatccaaacagtgtataagattttggctactattctgcacttgggaaattta
aaatttgtagtagatggtgacacgcctcttattgagaatggcaaagtagtgtctatcata
gcagaattgctgtctactaagacagacatggttgagaaagcccttctttaccggaccgtg
gctacaggccgtgacatcatcgataagcagcacacagaacaagaggccagctacggcaga
gacgcctttgccaaggcaatatatgagcgccttttttgttggatcgttacttgcatcaat
gatattattgaggtcaagaactatgacaccacagtccatgggaaaaacactgttattggt
gtcttggatatctatggctttgaaatctttgacaacaacagttttgaacaattctgcatc
aattattgcaatgagaaactgcagcagctatttattcagctggttctgaagcaagaacaa
gaggaataccagcgggaagggatcccctggaaacacattgactacttcaacaatcagatc
attgttgacctcgtggagcagcagcacaaagggatcattgcaatcctcgatgacgcttgc
atgaatgtcggcaaagtcactgatgaaatgtttcttgaagcacttaacagtaaattaggc
aaacatgtccatttttctagccgaaagctctgtgcctcagacaaaattctggagtttgat
cgagattttcgaattcgacattatgcaggagatgtggtctattctgtcattggttttatt
gacaaaaataaagatactttatttcaagatttcaagcgccttatgtataacagttcaaat
cctgtgctcaagaatatgtggcctgaaggcaaactgagcattacagaggtgaccaagcga
cctctgactgctgctaccttgtttaagaattctatgattgctttagtagacaaccttgca
tcaaaggaaccatattacgttcgttgcatcaaacccaatgacaagaaatctccacagata
tttgatgatgaacgctgccggcaccaagtagaatatcttggactactggaaaatgtgaga
gtgcgtcgggcaggatttgccttccgccagacatatgagaagtttcttcacaggtataag
atgatctctgaattcacctggcccaaccatgaccttccttcagataaagaggctgtcaag
aaactgattgaacggtgtggttttcaggatgatgtagcttatggaaagaccaaaattttc
attcgaacaccccgaacgttgtttaccttggaagaactccgtgcccagatgctcataagg
attgttctctttctacaaaaggtgtggcggggcaccctggcccgcatgcggtacaaaaga
accaaggcagctctgactataatcaggtactaccggcgctacaaagtgaagtcatacatc
cacgaggtggccagacgcttccatggcgtcaagaccatgcgagactacgggaagcacgtg
aagtggccaagccctcctaaagttcttcgccgtttcgaagaggccctgcagacgattttc
aatagatggagagcatcccagctcatcaagagcattcctgcctcagacctgccccaggtc
agggcaaaggttgcagccatggaaatgctgaagggtcaaagggctgacctcgggctccag
agggcctgggagggcaactatcttgcttcaaagccagatacacctcagacctcaggcact
tttgtccctgttgctaatgaattgaaacggaaggacaaatacatgaatgtcctcttttcc
tgtcatgtccgtaaggtaaatcgatttagtaaggtggaagacagagcaatttttgtcact
gaccgtcacctatataaaatggatcccactaaacagtacaaggtgatgaagactatccct
ctatacaatttgactggtctgagtgtctccaatggaaaagaccaacttgtagtgttccat
acaaaagacaacaaagacctcattgtctgcctcttcagcaaacagccaacccatgagagt
cgaattggagaacttgttggagtgctggtgaatcatttcaagagtgagaagcgccacctt
caagtgaacgtcaccaacccagtacagtgtagcctgcacgggaagaagtgcaccgtctcc
gtggagacgcggctcaaccagccccagcccgacttcaccaagaaccgctcgggcttcatc
ctcagcgtgcccgggaactga

DBGET integrated database retrieval system