KEGG   Chlorocebus sabaeus (green monkey): 103243169Help
Entry
103243169         CDS       T04361                                 

Gene name
CACNG5
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 5
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04010  MAPK signaling pathway
csab04260  Cardiac muscle contraction
csab04261  Adrenergic signaling in cardiomyocytes
csab04921  Oxytocin signaling pathway
csab05410  Hypertrophic cardiomyopathy (HCM)
csab05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
csab05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103243169 (CACNG5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103243169 (CACNG5)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103243169 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    103243169 (CACNG5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    103243169 (CACNG5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    103243169 (CACNG5)
   05414 Dilated cardiomyopathy (DCM)
    103243169 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:csab04040]
    103243169 (CACNG5)
Ion channels [BR:csab04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103243169 (CACNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 COPI_assoc SUR7 DUF716 DHHC
Motif
Other DBs
NCBI-GeneID: 103243169
NCBI-ProteinID: XP_008010229
Ensembl: ENSCSAG00000004125
Position
16
AA seq 275 aa AA seqDB search
MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSGLWR
VCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILSNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRG
RSPSDISSEASLQMNSNYPALLKCPDYDQMSSSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcctgcgggaggaaggccctgaccctgctgagcagcgtctttgctgtctgtggc
ctgggcctcctgggtatcgcagtcagcaccgactactggctgtacctggaggagggtgtg
attgtaccccagaaccagagcaccgagatcaagatgtccctgcactcaggcctctggcgg
gtctgcttccttgcaggtgaggagcgggggcgttgcttcaccatagaatatgtgatgccc
atgaacacccagctgacatccgagtccacggtcaatgtgctgaagatgatccgctcagcc
acaccattccctctggtcagcctcttcttcatgttcattgggtttatcctgagcaacatt
ggacacatccgtccccaccggacaatactggcctttgtctctggcatcttctttatcctc
tcaggcctctctctcgtggtgggcctggtgctctacatctccagcatcaacgacgagatg
ctcaacaggaccaaggacgcagagacctacttcaactacaagtatgggtggtcgtttgcc
ttcgccgccatctctttccttttaacggagagtgctggggtgatgtctgtgtacctgttc
atgaagcggtacaccgcagaggacatgtacaggccccaccctggcttctaccgccctcgg
ctgagcaactgctccgattactcaggccagttcctacacccagacgcctgggtcaggggc
cgcagcccctccgacatctccagcgaggcctccctgcagatgaacagcaactaccccgcc
ttgctcaagtgccctgactatgaccagatgtcctcttcgccctgctga

DBGET integrated database retrieval system