KEGG   Chlorocebus sabaeus (green monkey): 103243854Help
Entry
103243854         CDS       T04361                                 

Gene name
DHX8
Definition
(RefSeq) DEAH-box helicase 8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:csab00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103243854 (DHX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:csab03041]
    103243854 (DHX8)
Enzymes [BR:csab01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     103243854 (DHX8)
Spliceosome [BR:csab03041]
 Complex C
  Other components
   Step II factors
    103243854 (DHX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind S1 Helicase_C DEAD AAA_22 T2SSE AAA_19 Flavi_DEAD AAA_30 AAA_16 PhoH Sigma54_activ_2 Presenilin SLC12
Motif
Other DBs
NCBI-GeneID: 103243854
NCBI-ProteinID: XP_008011631
Ensembl: ENSCSAG00000003443
Position
16
AA seq 1195 aa AA seqDB search
MAVAVAIAGAIIGSEPGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKN
TTFDTFKASLVKNGAEFTDSLISNLLRLIQTMRPPAKPSTSKDPVVKPKTEKEKLKELFP
VLCQPDNPSVRTMLDEDDVKVAVDVLKELEALMPSAAVQEKQRDTEHRDRTKKKKRSRSR
DRDRDRDRDRERNRDRDHKRRHRSRSRSRSRTRERNKAKSRYRSRSRSQSPPKDRKDRDK
YGERNMDRWRDKHVDRPPPEEPTIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISEL
RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQESGEDLNPNRRRNLVGDTNE
ETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKWEIKQVGAINEDLEIELVEEE
PPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELKQAQREAEMDSIPMGL
NKHWVDPLPDAEGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQMSILEQRESL
PIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMS
VAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLD
EAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVE
ILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVP
ELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVY
NSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNL
ASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPL
EPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTL
LAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQK
AIWSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREV
TTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRRR
NT seq 3588 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggctgtagccatagcgggagccataatcgggtcggagccaggccccgcggaa
gaacttgccaaactcgagtacctgtctttggtgtcaaaggtttgcactgagctggacaat
cacttggggatcaacgacaaggaccttgctgaatttgtgatcagtcttgctgagaaaaat
accacctttgatacttttaaggcttccctcgtcaaaaatggtgcagaatttacggattct
cttattagtaacttgctgcgtctcatacaaaccatgcggcctccagcgaagccttccact
agcaaagatccagttgttaaacctaaaacagaaaaagaaaaactgaaggaactcttccca
gtcctttgccaaccggacaacccttctgttcggaccatgttggatgaagatgatgtgaaa
gttgctgtggatgtcctgaaagaactggaagctttaatgcccagtgcagcagtccaggag
aagcagagagatactgagcaccgggacaggacaaagaagaagaaacggagtcgaagccga
gatcgagatcgagatcgagaccgagatagggaacgaaaccgagatagagaccacaagcgg
agacaccgatcccgctctcgatcacgttccaggacccgggagaggaataaagcaaagtct
agatatcggtccaggagcagaagtcagagtccccccaaagaccggaaggaccgggacaaa
tatggagagcggaatatggatagatggcgggataagcatgtggaccgccctcctccagaa
gagcccaccattggtgacatttataatggcaaagttaccagcatcatgcagtttggttgc
tttgtgcagctggaagggctcaggaagcgatgggaaggcctggtgcacatctctgagctc
cggcgggagggtcgtgtggccaatgtagctgatgtggtgagcaaaggccagagggtcaaa
gtcaaagtgctgtccttcactgggaccaagaccagcctgagcatgaaggatgtggatcaa
gagtctggagaagatctaaacccaaatagacggcgaaatcttgtcggggacaccaatgag
gagacctcaatgcggaatcctgatagacccactcacctgtcccttgtcagtgcccctgaa
gtagaggacgactcactggaacgcaagcgcctcacccgaatctctgacccagagaagtgg
gagatcaaacaggttggggccattaatgaggaccttgagattgaattggttgaggaagag
cctccattcctgagaggacacactaagcaaagcatggacatgagccccattaaaatcgtc
aagaaccctgatggctccctctcccaagcggcaatgatgcagagtgccttggccaaagaa
aggcgggaacttaagcaggcccagcgggaagccgagatggattctattcccatgggactc
aacaaacactgggttgaccctctgcctgatgcggaaggcagacagattgctgccaacatg
aggggtattgggatgatgcccaatgatattcccgagtggaagaagcatgcctttgggggc
aataaagcctcttatgggaaaaagacccagatgtcaatccttgagcaaagggagagcctg
ccaatctacaaactgaaggagcagttggtccaggccgtccatgacaatcagatcctgatt
gttattggtgagacaggatctggaaagacaacgcagatcacccagtacctggcagaggca
ggctacacttccaggggcaagattgggtgtacccagcccagaagagtggcagctatgtca
gtggccaaaagagtgtcggaggagtttggttgttgcttaggccaagaggtgggctacacc
attcgatttgaggactgcactagccctgaaacagtcatcaagtacatgacagatgggatg
ttgcttagagagtgcttgattgaccctgacctcactcagtatgccatcatcatgttggac
gaagcgcacgagaggacaattcacactgatgtgctctttggattgttgaaaaagacagtt
cagaaacggcaggacatgaagctgattgtcacctcagccaccttggatgcagtgaagttt
tctcaatacttctatgaagctcccattttcaccatcccaggtcgaacatatccagtggaa
atactgtacacaaaggaacctgagacagattatctggatgccagcctgattactgttatg
cagattcatttaacagagccaccaggtgatatcctggtcttcctgactggtcaggaagaa
attgatactgcttgtgagatcctgtatgaaagaatgaaatccctgggacctgatgtacca
gagttaattatcctcccagtgtactctgctcttcccagtgagatgcagacccgaatcttt
gacccagctccaccaggcagcagaaaggttgtgattgccaccaatattgcagagacatcg
ctgactattgatggtatctactatgtggtggacccaggatttgtgaagcagaaagtttac
aattccaagacagggattgaccagctcgtggtaacgcctatttctcaggctcaggcaaag
caacgagctggcagagctgggagaacaggcccaggaaagtgttacaggctgtacacagaa
cgtgcctaccgagatgaaatgctgaccacaaacgtgccggaaatccagagaaccaactta
gcgagcacagtgctgtcactcaaggccatgggtatcaatgatctgctgtcctttgatttc
atggatgccccaccaatggaaactttgatcacagccatggagcagctgtacacactggga
gccctggatgacgagggcctgcttactcgcttgggccgccggatggcagagttccctctg
gagccaatgctatgcaaaatgctcatcatgtctgtgcatctgggctgcagtgaggaaatg
ctgaccattgtatccatgttgtctgtgcagaacgtcttctataggcccaaggataaacaa
gcccttgcagatcagaagaaggccaaattccaccagactgaaggggaccacctcaccctg
ctagctgtgtacaactcctggaagaacaacaagttctccaacccatggtgctatgagaac
tttatccaggctcgttccctgcgccgggcccaggacattcgcaagcagatgttaggcata
atggacagacacaagctggatgttgtttcctgtggcaagtccacagtccgagtgcagaag
gccatctggagtgggttcttccgtaatgctgccaagaaagacccgcaggagggttatcga
acactgatcgaccagcaggtggtctatatccatccttccagtgctctcttcaacagacag
ccagaatgggtggtgtaccatgagctggtgctgaccaccaaggaatacatgcgtgaagtt
accaccatcgaccctcggtggcttgtggagtttgccccagccttcttcaaggtctcagac
ccaactaagctaagcaaacagaagaagcaacagcgtcttgaacccttgtacaaccgctat
gaggaacccaacgcctggagaatatcccgggccttccgacggcgctga

DBGET integrated database retrieval system