KEGG   Chlorocebus sabaeus (green monkey): 103244082Help
Entry
103244082         CDS       T04361                                 

Gene name
CNDP1
Definition
(RefSeq) carnosine dipeptidase 1
  KO
K05604  beta-Ala-His dipeptidase [EC:3.4.13.20]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00330  Arginine and proline metabolism
csab00340  Histidine metabolism
csab00410  beta-Alanine metabolism
csab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    103244082 (CNDP1)
   00340 Histidine metabolism
    103244082 (CNDP1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103244082 (CNDP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:csab01002]
    103244082 (CNDP1)
Enzymes [BR:csab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.20  beta-Ala-His dipeptidase
     103244082 (CNDP1)
Peptidases [BR:csab01002]
 Metallo Peptidases
  Family M20
   103244082 (CNDP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 WG_beta_rep
Motif
Other DBs
NCBI-GeneID: 103244082
NCBI-ProteinID: XP_008011959
Ensembl: ENSCSAG00000018230
UniProt: A0A0D9S056
Position
18
AA seq 512 aa AA seqDB search
MDPKLGRMAASLLAVLLLLEGDMFSSHSVPPALLEKVFQYIDLHQDEFVQTLKEWVAIES
DSVQPVPRFRQELFRMMAVAADTLQRLGTRVTSVDMGSQQLPDGQSLPIPPVILAELGND
PTKRTVCFYGHLDVQPADQGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFR
ALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKNRFFSGVDYIVISDNLWISQRKPAITY
GTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVAP
LTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGA
KTVIPGQVIGKFSIRLVPHMNVSVVEKQVTQHLEDVFSKRNSSNKMVVSMTLGLHPWIAN
INDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQN
EKINRWNYIEGTKLFAAFFLEMAQLHHKNLLV
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggatcccaaactcgggagaatggctgcgtccctgctggctgtgctgctgctgctggag
ggagacatgttctcttcacactccgtgcccccggcgctgctagagaaagtcttccagtac
attgacctccatcaggatgaatttgtgcagacgctgaaggagtgggtggccatcgagagc
gactctgtccagcccgtgcctcgcttcagacaagagctcttcagaatgatggctgtggcc
gcggacacactgcagcgcctggggacccgtgtgacctcggtggacatgggttctcagcag
ctgcccgatggtcagagtcttccaatacctcccgtcatcctggccgaactggggaacgat
cccacgaaacgcaccgtgtgcttctacggccacttggacgtgcagcctgccgaccagggc
gatgggtggctcacggacccctacgtgctgacggaggtggacgggaaactttatggacga
ggcgcaaccgacaacaaaggtcctgtcttggcttggatcaatgctgtgagcgccttcaga
gccctggagcaagatcttcctgtgaatatcaaattcatcattgaggggatggaagaggct
ggctctgttgccctggaggaacttgtggaaaaagaaaagaaccgattcttctctggtgtg
gactacatcgtaatttcagataacctgtggatcagccaaaggaagccagcaatcacttac
ggaacccgggggaacagctacttcatggtggaggtgaaatgcagagaccaggattttcac
tcgggaacctttggtggcatccttcatgaaccaatggctgatctggttgctcttctcggt
agcctggtagactcgtcgggtcatatcctggtccctggaatctatgatgaagtggctcct
cttacagaagaggaaataaatacatacaaagccatccatctagacctggaagaataccgg
aatagcagccgggttgagaaatttctgttcgatactaaggaggagattctaatgcacctc
tggaggtacccatctctttctattcatgggatcgagggtgcgtttgatgagcctggagct
aaaacagtcatacctggccaagttataggaaaattttccatccgtctagtccctcacatg
aatgtgtctgtggtggaaaaacaggtgacacagcatcttgaagatgtgttctccaaaaga
aatagttccaacaagatggttgtttccatgactctaggactacacccatggatcgcaaat
attaacgacacccagtatctcgcagcaaaaagagccatcagaacagtgtttggaacagaa
ccagatatgatccgggatggatccaccattccaattgccaaaatgttccaggagattgtc
cacaagagcgtggtgctaattccgctgggagctgttgatgatggagaacactcacagaat
gagaaaatcaacaggtggaactacatagagggaaccaaattatttgctgcctttttctta
gagatggcccagctgcatcacaagaaccttctagtctga

DBGET integrated database retrieval system