KEGG   Chlorocebus sabaeus (green monkey): 103245365Help
Entry
103245365         CDS       T04361                                 

Gene name
PIGT
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
csab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    103245365 (PIGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 103245365
NCBI-ProteinID: XP_008014178
Ensembl: ENSCSAG00000014400
UniProt: A0A0D9RPJ0
Position
2
AA seq 578 aa AA seqDB search
MAAAMPLALLVVLLLGRRGWCLAEPPRDSLREELVITPLPSGDVAATFQFRTRWDSELQR
EGVSHYRLFPKALGQLISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWFQDTV
TDVDKSWKELSNVLSGIFCASLNFIDSTNTVTPTASFKPLGLANDTDHYFLRYAVLPREV
VCTENLTPWKKLLPCSSKAGLSVLLKADRLFHTSYHSQAVHIRPVCRNARCTSISWELRQ
TLSVVFDAFITGQGKKDWSLFRMFSRTLTEPCPLASESRVYVDITNYNQDNETLEVNPPP
TTTYQDVILGTRKIYAIYDLLDTAMINNSRNLNIQLKWKRPPENEAPPVPFLHAQRYVSG
YGLQKGELSTLLYNTHPYRAFPVLLLDTVPWYLRLYVHTLTITSKGKENKPSYIHYQPAQ
DRLQPHLLEMLIQLPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSVVA
AKPVDWEESPLFNSLFPVSDGSNYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVVAVCY
GSFYNLLTRTFHIEEPRTGGLAKRLANLIRRARGVPPL
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctatgccgcttgctctgctcgtcgtgctgctcctggggcgcagaggctgg
tgccttgcagaacccccacgcgacagcctgcgagaggaacttgtcatcaccccactgcct
tccggggacgtagctgccacattccagttccgcacgcgctgggattcggagcttcagcgg
gaaggagtgtctcattacaggctctttcccaaagccctggggcagctgatctccaagtat
tctctacgggagctgcacctgtcattcacacaaggcttttggaggacccgatactgggga
ccacccttcctgcaggccccatcaggtgcagagctctgggtctggttccaagacactgtc
actgatgtggataaatcttggaaggagctcagtaatgtcctctcagggatcttctgcgcc
tctctcaacttcatcgactccaccaacacggtcactcccactgcctccttcaaacccctg
ggtctggccaatgacactgaccactactttctgcgctatgctgtgctgccgcgggaggtg
gtctgcactgaaaacctcaccccctggaagaagctcttgccctgtagttccaaggcaggc
ctctctgtgctgctgaaggcggatcgcttgttccacaccagctaccactcccaggcagtg
catatccgccctgtttgcagaaatgcacgctgtactagcatctcctgggagctgaggcag
accctgtcagttgtatttgatgccttcatcacggggcaggggaagaaagactggtccctc
ttccggatgttctcccgaaccctcacagagccctgccccctggcttcagagagccgagtc
tatgtggacatcaccaactacaaccaggacaacgagacattagaggtgaacccacccccg
accactacctatcaggacgtcatcctgggcactcggaagatctatgccatctatgacttg
cttgacaccgccatgatcaacaactctcgaaacctcaacatccagctcaagtggaagaga
cccccagagaatgaggcccccccagtgcccttcctgcatgcccagcggtatgtgagcggc
tatgggctgcagaagggggagctgagcacactgctgtacaacacccacccataccgggcc
ttcccagtgctgctgctggacaccgtaccctggtatctgcggctgtatgtgcacaccctc
accatcacctccaagggcaaggagaacaaaccaagttacatccactaccagcctgcccag
gaccggctgcaacctcacctcctggagatgctgattcagctgccggccaactcagtcacc
aaggtttccatccagtttgagcgggcgctgctgaagtggaccgaatacaccccagatcct
aaccatggcttctatgtcagcccatctgtcctcagcgcccttgtgcccagcgtggtagca
gccaagccagtggactgggaagagagtcccctcttcaacagcctgttcccagtctccgat
ggctctaactactttgtgcggctctacacggagccgctgctggtgaacctgccgacacct
gacttcagcatgccctacaacgtgatctgcctcacgtgtactgtggtggccgtgtgctat
ggctccttctacaatctcctcacccgaaccttccacatcgaggagccccgcacaggtggc
ctggccaagcggctggccaacctcatccggcgtgcccgaggtgtccccccactctga

DBGET integrated database retrieval system