KEGG   Chlorocebus sabaeus (green monkey): 103245776Help
Entry
103245776         CDS       T04361                                 

Gene name
PLA2G4D
Definition
(RefSeq) phospholipase A2 group IVD
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00564  Glycerophospholipid metabolism
csab00565  Ether lipid metabolism
csab00590  Arachidonic acid metabolism
csab00591  Linoleic acid metabolism
csab00592  alpha-Linolenic acid metabolism
csab01100  Metabolic pathways
csab04010  MAPK signaling pathway
csab04014  Ras signaling pathway
csab04072  Phospholipase D signaling pathway
csab04217  Necroptosis
csab04270  Vascular smooth muscle contraction
csab04370  VEGF signaling pathway
csab04611  Platelet activation
csab04664  Fc epsilon RI signaling pathway
csab04666  Fc gamma R-mediated phagocytosis
csab04724  Glutamatergic synapse
csab04726  Serotonergic synapse
csab04730  Long-term depression
csab04750  Inflammatory mediator regulation of TRP channels
csab04912  GnRH signaling pathway
csab04913  Ovarian steroidogenesis
csab04921  Oxytocin signaling pathway
csab05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103245776 (PLA2G4D)
   00565 Ether lipid metabolism
    103245776 (PLA2G4D)
   00590 Arachidonic acid metabolism
    103245776 (PLA2G4D)
   00591 Linoleic acid metabolism
    103245776 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    103245776 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103245776 (PLA2G4D)
   04010 MAPK signaling pathway
    103245776 (PLA2G4D)
   04370 VEGF signaling pathway
    103245776 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    103245776 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103245776 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103245776 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    103245776 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    103245776 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103245776 (PLA2G4D)
   04913 Ovarian steroidogenesis
    103245776 (PLA2G4D)
   04921 Oxytocin signaling pathway
    103245776 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103245776 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    103245776 (PLA2G4D)
   04726 Serotonergic synapse
    103245776 (PLA2G4D)
   04730 Long-term depression
    103245776 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103245776 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    103245776 (PLA2G4D)
Enzymes [BR:csab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     103245776 (PLA2G4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 103245776
NCBI-ProteinID: XP_008015112
Ensembl: ENSCSAG00000008343
Position
26
AA seq 816 aa AA seqDB search
MESLSPGGPPGHPYQWEASACWQLTVRVLEARNLRRADLLSEADPYVILQLSTVPGMKFK
TKTLTDTSHPVWNEAFHFLIQSQVKNVLELSIYDEDSITEDDICFKVLYDISEVLPGKLL
RKTFSQSPQGEEELDVEFLMEETSDRPENLITNKVLVARELSCLDVHLDSAGSTTVVADQ
DKLELELELKGSYEDTQTSSLGTASAFRFHYMAALETELSGRLRSSTSNVWNGDNSARRL
TVPLRPLIGKEVTMDVPAQDVPGVRLQLKAEGCSKELAVHLGFSLCAEEQAFLSRRKQVV
AKALKQALQLDGDLQEDEVPIVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFSGVS
GSTWTMAHLYGDPEWSQKDLEEPIRYAQEHLAKSKLEVFSPERLASYRRELELRAEQGHP
TSFVDLWALVLESMLHGQVMDQKLSGQRAALERGQNPLPLYLSLNVKENNLETLDFKEWV
EFSPYEVGFLKYGAFVPPELFGSKFFMGRLMRRIPEPRICFLEAIWSNVFSLNLLDAWYD
LTSSGESWKQHIKDKTRSLEKEPLTSLETSWLEASWLQPGTALAQAFKGFLTGRPLHQCS
PNFLQGLQLHQDYCSHKGFSTWADCQLDSTPSQLTPQEPQLCLVDAGYFINTSCPSMFRP
GRRLDLILSFDYSLSAPFEALQQTELYCRARGLPFPRVEPSPQDHQQPRECHLFSDPACP
EAPILLHFPLVNASFKDHSAPGVQRSPAELQAGQVNLTGATSPYALSNMTYKEEDFERLL
RLSDYNVQTSQGAILQALRTALKHRALEARPPGAQT
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atggagagtctgtcacctgggggaccacctggccatccttaccagtgggaggcctctgcc
tgctggcagctcaccgtgagggtcctggaggcgcggaacctgcgcagggctgacctgttg
agtgaggccgacccgtacgtgatcctacagctgtccaccgtgcctggaatgaagtttaag
accaagacgctcaccgacaccagtcatcctgtgtggaatgaggccttccatttccttatc
caaagtcaggtcaagaatgttctggaacttagcatctatgatgaggactcaatcacggag
gatgacatctgcttcaaggttctctatgatatctcagaagtcctccctggcaagctgctc
cggaaaaccttctcccagagtccccagggagaggaggagttggatgtggagttcctgatg
gaagaaacgtcggatcgcccagaaaacctcatcaccaacaaagtccttgtggcccgagag
ctgtcatgcctggatgtgcatctggacagcgcaggtagcaccactgtggttgcagatcag
gacaagttagagctggagctggagttgaaggggtcctatgaggacacacagacatcctcc
ctgggcacagcctctgccttccgcttccactacatggcagccctagagacagagctgagt
gggcgcctgaggagctccacaagcaatgtctggaatggggacaactcagctcggcgcctc
actgtgcccctgaggcctttgatcgggaaggaggtgaccatggatgttcctgctcaagat
gtcccaggagtgaggctgcagctcaaggcagagggctgctccaaggagctggccgtgcac
ctgggcttcagtctgtgtgcagaggagcaggccttcctgagcaggaggaagcaggtggtg
gccaaggccctgaagcaggccctgcagctggacggagacctgcaggaggacgaggtaccc
atcgtgggcatcatggccacaggaggaggtgcccgggccatgacctcgctctatggccac
ctgttggccctgcagaagctgggcctgctggactgtgtgacctacttcagtggcgtctct
ggctctacgtggacaatggcccacctgtacggggaccctgagtggtcgcagaaggacctg
gaggaacctatccgatatgcccaggagcacctggccaagagcaagctggaggtcttttcc
ccagagcgcctggcgagttaccgccgggagctggagctgcgggctgagcagggccacccc
acatcttttgtggacctgtgggcgctagtgctggagtccatgctgcacggccaggtgatg
gatcagaagctgtcaggacagagagccgccctggaacggggtcagaaccctctgcccctc
tacctgagcctcaatgtcaaagagaacaatctggagacgctggacttcaaggagtgggtt
gagttctccccctatgaggtcgggttcctgaagtacggagccttcgtccctcctgagctc
ttcggctccaagttcttcatgggacggctgatgaggaggatcccggagccccggatctgc
tttctggaagccatctggagcaacgttttctccctgaacctgctggacgcctggtatgac
ctcaccagctctggggagtcctggaaacagcacatcaaggacaagaccaggagcttagag
aaggagcccctgacctccttggagacctcgtggctggaggcctcatggctgcagccgggc
acggcgctggcccaggcatttaaagggttcctgaccggcaggcccctccaccagtgcagc
cccaacttcctccagggcctccagctacaccaggactactgcagccacaaaggcttctcc
acctgggcagactgccagcttgactccacgcccagccagctgactccccaggagccccag
ctctgcctggtggacgctggctacttcatcaacaccagctgtccctccatgttccggccg
ggccgcaggctggacctcatcctctccttcgactactctctatctgcgccctttgaggcg
ctgcagcagacagagctgtactgccgggcccgggggctgcccttcccccgggtggaaccc
agccctcaggaccaccagcagccaagggagtgccacctcttctcagaccctgcctgcccc
gaggccccgatcctgctgcatttcccgctggtcaatgcctccttcaaggaccactcagct
cccggtgtccagcgcagccccgcagagctccaggctggccaagtgaatctcactggggct
acctccccgtacgccctgtccaacatgacctacaaggaggaagacttcgagcgcctgcta
cggctcagcgactacaacgtgcagaccagccagggtgccatcctgcaggccctgaggacc
gcactgaagcaccgggccctagaggcgaggcctccaggggcacagacctga

DBGET integrated database retrieval system