KEGG   Camelina sativa (false flax): 104701093Help
Entry
104701093         CDS       T05044                                 

Definition
(RefSeq) aspartic proteinase-like
  KO
K08245  phytepsin [EC:3.4.23.40]
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:csat01002]
    104701093
Enzymes [BR:csat01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.40  phytepsin
     104701093
Peptidases and inhibitors [BR:csat01002]
 Aspartic peptidases
  Family A1: pepsin family
   104701093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp TAXi_N SapB_2 SapB_1 Asp_protease_2 TAXi_C zf-FPG_IleRS DHQ_synthase
Motif
Other DBs
NCBI-GeneID: 104701093
NCBI-ProteinID: XP_010415029
Position
7
AA seq 504 aa AA seqDB search
MISTEARNKLIHQATCFCLLAILLHPTTSTNLFRVALKKRQLELDDIRAGRMISKLKYSH
SQHPSDYQSFATLGGGSSDQDHQVILKNYLNAQYYGVIAIGTPPQEFKVLFDTGSSNLWV
PSSKCYLSLTCYLHPKYKSTKSKTYTKNGKPGSIKYGSGSMSGFFSEDNVKVGDLVVKNQ
EFIEATRERSLTYLLAKFDGLLGLGFQISVGNAVPVWYNMVDQGLVKDKVLSFWLNRDTK
AEVGGEIVFGGVDHFKGNHTYVPVTRKGYWQFNMGDIFVNNNSTGFCEQGCGAIMYSGTS
LIAGPTTVIAQINHAIGAKGVVSAECNEIISQYGELIWDLLVSKMPRRQVCKELGLCVFR
QETGIKTVVEKERSSVLCKVCEMVVVWIHTKLKMNETKEKVFEYVYQLCESHLSPAGEAV
FDCNNIENMPNVTFTIGGNHFSLTPQQYILKTRVGHTEMCISGFAGYDLPSPTGPLWIIG
DVFMGAYHTVFDSGNLQIGIAEAT
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgatttccactgaagcacgaaacaaacttatccatcaagccacttgtttctgtctctta
gcaatcttgcttcatccaacaacctccactaatctgtttcgtgttgctctgaagaagaga
cagcttgagcttgacgatataagagccggcagaatgatcagtaagctgaaatattcacat
tcacaacatccctcagattaccagtcttttgctactttaggaggtggttctagtgaccaa
gatcatcaggtgattcttaaaaactacctgaacgctcaatactatggagttattgcaatt
ggaacgcctccacaagaattcaaagttctattcgataccggaagttccaatctttgggtt
ccatcttcaaaatgttacttatctctgacttgttatctccatcccaagtacaagtccacc
aaatccaaaacatacaccaagaatggaaagccaggttcgataaaatatgggtcagggtcg
atgtctggcttctttagcgaggacaatgtgaaagttggtgatcttgtagtcaagaatcag
gagtttatcgaagctacacgcgaaaggagtctcacttatctcctagcaaagtttgatggt
ctactcgggttaggatttcagatttcagtcggaaatgcggtaccagtttggtacaacatg
gtggatcaaggactagtgaaggataaagttttgtcattctggctaaaccgtgataccaaa
gctgaagttggaggtgagattgtgtttggcggtgttgatcacttcaaaggcaaccacacc
tatgtccctgtcactagaaaaggctattggcagtttaacatgggcgatatcttcgttaat
aacaactcaactggtttttgtgagcaaggttgtggtgcaattatgtactcaggaacttca
ctgattgctggaccaactaccgtgattgcacaaataaaccacgcaattggcgctaaggga
gttgtaagtgctgagtgcaatgaaattatctctcaatatggagaactgatatgggatctg
ttagtttcaaagatgccacgtcgtcaagtgtgtaaagagcttggactctgcgttttccga
caagagaccggaataaaaacagttgtggagaaagaaagatcatcagtcctatgtaaagtt
tgtgagatggttgttgtttggattcatacaaaactgaaaatgaatgaaaccaaagagaaa
gtgtttgaatacgtataccagctttgtgagagccatctcagtcccgcaggcgaggcagtt
ttcgactgcaataacatcgaaaacatgccaaatgttacatttacaattggtggcaaccac
ttctctctcacccctcaacagtacattctcaaaactcgagttggtcatactgagatgtgc
ataagcgggtttgccggttacgacttgccttcaccgactggtcctctctggattattggg
gatgtctttatgggagcctaccacaccgtattcgattcaggcaatcttcaaatcggaata
gcagaagctacataa

DBGET integrated database retrieval system