KEGG   Camelina sativa (false flax): 104705898Help
Entry
104705898         CDS       T05044                                 

Definition
(RefSeq) caffeoylshikimate esterase-like
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00561  Glycerolipid metabolism
csat01100  Metabolic pathways
Module
csat_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    104705898
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:csat01002]
    104705898
Enzymes [BR:csat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     104705898
Peptidases [BR:csat01002]
 Serine Peptidases
  Family S33
   104705898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Peptidase_S9 Abhydrolase_2 DLH FSH1 Esterase Peptidase_S15 Abhydrolase_4 Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 104705898
NCBI-ProteinID: XP_010420291
Position
8
AA seq 380 aa AA seqDB search
MALRSAKLTLFSPLHGFVDKGRRFVWQRSSSSSRSMAPMVKLDKDEELRRLKEVNIDEAS
ARRHVRDSLKDIQLNLDHILFQTPENGIKTKESYEMNSRGIEIFSKSWLPEATSLKALVC
FCHGYGDTCTFFFEGIARRLALSGYGVFAMDYPGFGLSEGLHGYIPSFDLLVQDVMEHYS
KIKENPEFSSLPSFLFGQSMGGAVSLKIHLKQPNAWTGAVLVAPMCKIADDLVPPPVLKQ
ILIGLANVLPRHKLVPQKDLAEAAFRDVRKREMTPYNVICYSGKPRLRTAVEMFHTTQEI
EKQLQKVSLPILILHGEADTVTDPSVSRELYEKAKSSDKKIVLYEDAYHSLLEGEPDDMI
LRVLSDIILWLDEHSLQTEG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggctctgagatcagcaaagcttacccttttcagtcctttacacgggtttgtggataaa
ggaagaagatttgtgtggcaacgaagtagtagtagtagtagatcgatggctccgatggtg
aagctagacaaagatgaggagctccggcgactcaaggaggttaatattgacgaagcttca
gcgcgtcgtcatgttcgtgattccttaaaagacatccagcttaatctcgatcatatcctc
ttccagacacctgaaaatggaattaagactaaggagtcttatgagatgaattcgagagga
attgagatcttctccaaaagctggcttcctgaagctactagccttaaagctttggtttgt
ttctgccatggttatggagatacttgcacctttttcttcgaagggattgcaaggagattg
gcattatctggttatggagttttcgctatggattatccgggatttggcttatcagagggc
ttgcacggttatatccctagctttgatcttcttgttcaagatgtcatggagcattactcc
aagataaaagagaatcccgaatttagttctcttcctagctttctctttggacagtcaatg
ggtggagccgtgtcgctcaaaatacatctcaaacaaccaaatgcgtggaccggcgcagtc
ttggtagcaccaatgtgcaaaattgcagatgatttggttccaccaccggtattaaaacag
attttgatcggtctagccaatgttctaccaagacataagttggttccacaaaaggattta
gcagaagcagcttttagagatgtcaggaagagggagatgacaccatacaatgtgatttgt
tacagtggcaaaccgcgactacgcactgcagtagaaatgtttcacacaactcaagagatt
gaaaaacaattgcaaaaggtgtctttgccaatattgattctacacggagaagctgataca
gtgacagatccttcagtgagcagagagctatacgagaaggcgaaaagttcagacaagaag
atagttttgtatgaagatgcttatcattctctgctcgaaggggaacctgacgacatgatt
cttcgtgtcttgtccgatatcatcttatggctggacgagcatagcttgcaaactgaggga
tga

DBGET integrated database retrieval system