KEGG   Camelina sativa (false flax): 104707683Help
Entry
104707683         CDS       T05044                                 

Definition
(RefSeq) equilibrative nucleotide transporter 4-like
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:csat02000]
    104707683
Transporters [BR:csat02000]
 Solute Carrier Family (SLC)
  SLC29: Facilitative nucleoside transporter
   104707683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran
Motif
Other DBs
NCBI-GeneID: 104707683
NCBI-ProteinID: XP_010422386
Position
8
AA seq 416 aa AA seqDB search
MVDQTPENLQGKYKAMVVCCILGVGSLVSWNSMLTIADYYYQIFPDYHPSRVLTLVYQPI
ALGTVMIFAYHESKISTRKRVLTGYILFTISTFLLIVLDMATKGHGGIGNYIVLCTIVAS
FGLADATVKGGLIGDLSLMSPELIQSYMAGSGMAGVLTSVLRLITKAAFDKSNNHLRKGA
MIFLAISTFIEFLCVMLYAYVFPKLPIVKYYRTKAASEGSKTVAADLAAAGIQNQSDLSD
DDSNSKNQRLSKKELLLQNIDYAVSLFLIYVLTLSIFPGFLYENTGQHGLGAWYALILVA
MYNFWDLVGRYVPLVSWLKVENRKALTIAVLSRYFLVPAFYFTAKYGDKGWMMMLVSVLG
LTTGHLTVCIMTIAPKGYKGPEKNALGNLLVVFILGGAVVGISLGWLWLIGKKNAF
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggtggatcaaactcctgagaatcttcaggggaagtataaagcaatggttgtttgctgt
attcttggagtcggatctctcgtttcttggaacagtatgctcactatcgcagattactac
taccaaattttcccggattatcatccttcaagggtactcacacttgtatatcaaccaatt
gcgcttggaactgtcatgattttcgcataccatgaatctaaaatcagtactcgaaaacgt
gtcctgaccggttacatcctattcacaatatccacattcttgctcatagtgttggatatg
gcaacaaaaggacacggtggaatcggaaactatattgttttatgcacaattgttgcttct
tttggcctcgctgatgctaccgttaaaggaggattgatcggtgacttatctttgatgtcc
cctgagctcatccagtcatatatggctggttcgggtatggctggtgttctaacctcagtg
cttaggctaataactaaagctgcctttgacaaatcaaacaaccatctacggaaaggagca
atgatattcttagcaatctcaacattcatagaatttctttgtgtgatgttatatgcttat
gtgttcccaaaactcccaatcgttaagtattaccgcacaaaagctgcttctgaaggatcg
aaaactgtagctgctgatcttgctgctgctggtatccaaaatcaatcagatttgagtgat
gatgactccaactccaagaatcaaaggctaagcaagaaagagctattacttcaaaacata
gactatgcagttagtctattcctcatctacgttttgacattatccatttttcctggattc
ttatacgagaacacgggacaacacggcctaggcgcttggtacgcgcttatcctagtagcc
atgtacaatttttgggatttggtcgggaggtatgtgccgctggtgagttggctgaaggtt
gagaatagaaaagcactaacgattgcggttttgtcccgatatttcctcgttccggcattc
tacttcaccgcaaaatatggtgataaaggatggatgatgatgctcgtttctgttttggga
ttaactactggacatctcactgtttgcattatgactatagctcctaaaggctacaagggt
ccggagaagaatgcattagggaatttgctggtggtttttatactaggaggagcagttgta
ggaatatctttgggttggttatggcttattggcaagaaaaatgcattttga

DBGET integrated database retrieval system