KEGG   Camelina sativa (false flax): 104708060Help
Entry
104708060         CDS       T05044                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH12, chloroplastic
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
csat  Camelina sativa (false flax)
Pathway
csat03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:csat00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    104708060
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:csat03041]
    104708060
Enzymes [BR:csat01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     104708060
Spliceosome [BR:csat03041]
 Complex C
  Other components
   Step II factors
    104708060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C IBR OB_NTP_bind HA2 DEAD zf-C3HC4_2 zf-RING_UBOX zf-RING_2 zf-C3HC4 AAA_22 AAA_19 AAA_30 zf-RING_5 Helicase_RecD zf-C3HC4_3 ABC_tran AAA_29 ResIII KH_1 Secretin_N
Motif
Other DBs
NCBI-GeneID: 104708060
NCBI-ProteinID: XP_010422848
Position
8
AA seq 1786 aa AA seqDB search
MRSSFPLSDGGRSETDRRHPSFPSSSTNRCYSRSPQYSPPLNHRPPTWNHHQHHSHYPNP
NFPPNDRRDRVTSPVISSTRPNFIVQLLHPRINAAAKREEIKSLALLCEIPEESVHVPQF
GCVAGSFSFRQWVDARSAVVALWEYRLRGEHDFVPELIPNVVVPSDMDELKDRLRDLFSA
HVISLMENGVGVKKVETEIDEKNRQVESFSSKRGLKFEVFEKKKAVESERYLVVKRLEEF
KNAMKSIVRFLKGKDGYESDGKEEEDVAVFSLEGAYDWRRIHCLIRRECRRLEDGLPIYS
YRRNILRRIHGEQITVLIGETGSGKSTQLVQFLADSGVAAGESIVCTQPRKIAAMTLADR
VREESSGCYEENTVRCTPTFSSTEQISSKVVFMTDNCLLQHYINDRSLSGISCVIIDEAH
ERSLNTDLLLALLKELLCTRVDLRLVIMSATADACQLSDYFFGCGKFLVNGRNFPVEIVY
SPCDTEETSVVGGIATYVGDVVKMAVEIHKTEKEGTILAFLTSQAEVEWACERFIAPSAV
ALPLHGKLSMEEQFRVFQNHPGKRKVIFATNIAETSLTIPGVKYVIDSGMVKESKYEPRT
GMSILKVCQVSQSSARQRAGRAGRTEPGRCYRLYSKNDFDSMSLNQEPEIRRVHLGVALL
RILALGVDNIADFDFVDAPVPEAIAMAVQNLVQLGAVVKKNGVLELTQEGHCLVKLGLEP
KLGKLILGCFRYRMGKEGIVLAAVMANASSIFCRVGNFDDKMKADRLKVQFCNHNGDLFT
LLSVYKEWASLPRERRNKWCWENSLNAKSMRRCEDTVKELEICIERELTLVSPSYWVWNP
SAGTKHDKHLKMVILASLAENVAMYTGYDQLGYEVALTGQQVQLHPACSLLAFGQKPSWV
VFGELLSIVDQYLVCVTAFDFEALYTLDPPPPFDASQMDERRLRVKKVVGCSSTVLKRFC
GKSNRSLLSIVSRARSLCRNERICIQVDVDQNAILLYAPPLDMEKVSALVNDALECEKKW
MRNECLEKYLFHGRGQVPIALFGSGAQVKHLEVDQRFLTVDVLYYGDNAVDDRELLMFLE
KRIDGCICSIHKFSANKQDCDEKEKWGRLTFLSPESAMKAAEIQKFDFNGSVLKLFPSLS
TSGGMFKMPYFPSVTAKILWPRRESTGRGCLKFPSGDIHSIFGGISNLEIGTNSAHIQRD
QKSNDSILISGLDSDLSEAEVLDVLELKTGIRDLNFFIFRKNSVQCPSPTACEEELYKRI
FAHMSARNPEPNCVKVQVFEPKEKDYFMRAYITFDGRYHLEAAKALQELNGQVLPGFLPW
QKIKCEQLFQSSIVCSSSIYNTVKRQLNVLLASFERQRGGDWRLEPTHNGAYRVKICAYA
TRPIAEMRRELEELVRGRPINHPGLTPRVLQHLMSRDGINLMRKIQQETETYIVLDRHNL
TVRICGSSQKIAEAERELVQSLVAYHESKQLEIHLRGPDIRPDLMKEVVRRFGPELQGIK
EKVHGVDLKLNTRYHVIQVHGSKEMREEVQKMVNELAREESAMGEKPDDIEVECPICLSE
VEDGYSLEGCSHLFCKACLLEQFEASMRNFDAFPILCSHVDCEAPIVLADMRALLSQQKL
DELFRASLSSFVTSSDGKFRFCSTPDCPSVYRVAGPQESGEPFICGACNAETCTRCHLEY
HPLITCERYKLFKENPDLSLQDWAKGKDVKECPICKCTIEKTDGCNHLLCRCGKHICWTC
LDVFTQAASCYAHLRTIHGGIGGVGDLVDLDIPLAEFGFPIDIPRP
NT seq 5361 nt NT seq  +upstreamnt  +downstreamnt
atgaggagctcttttcctctttccgacggtggaagatcggagactgatcgtcgtcatcct
tcgtttccctcatcctccacgaaccgttgttactctcgctctccacagtattctccgccg
ctcaatcaccgtcctcctacttggaaccaccatcagcatcactctcactaccctaacccc
aatttcccgccaaatgacagacgcgatcgggttacctcgccggtaatctcttctactagg
cccaatttcatcgttcagctacttcacccgaggattaacgccgccgctaagagggaagag
atcaagagtctcgctttgctctgcgaaatcccggaggagtctgttcatgtgcctcagttc
ggttgtgtcgccggaagtttcagttttcgtcagtgggtcgatgcgcgttccgccgtcgtg
gctctttgggagtatcggcttcgaggggagcatgattttgttcctgagctgattcctaat
gttgttgttccttctgatatggacgagcttaaagacaggcttcgtgatcttttctcggct
catgtgatttcgcttatggagaacggagtaggcgtcaagaaggtggaaactgagattgat
gagaagaatcgtcaagttgagtccttttcgtctaaaaggggtcttaaatttgaggttttt
gagaaaaagaaggctgttgagtcggagagatatttggtcgtgaagcggcttgaagaattc
aagaatgctatgaagagcattgtgagattcctcaaaggaaaagacgggtatgagtctgat
ggtaaggaagaagaagatgtggccgtgtttagtttggaaggggcttatgattggagacgt
attcattgtttgattcgtagggagtgtagaaggctagaggatggactgcctatatattcc
tatcgccggaatattttgaggaggattcatggtgaacagataacggtgttaattggagaa
actggttcagggaagagcactcagttagttcagttccttgctgattctggagttgctgct
ggtgagtcgattgtttgtacacaaccacggaaaattgctgccatgacattggctgatcgg
gtcagagaagaaagcagtggttgttatgaggaaaacactgtccgttgtactccaactttt
tcatctacggagcagattagttccaaagttgtattcatgacagataattgtctgcttcaa
cactacatcaatgataggagtttatctggcatttcatgcgttattatcgatgaagcccat
gaaagaagcttaaatacagaccttcttctcgcattgctcaaggagttgctatgcacaagg
gttgacctaaggcttgttatcatgtctgccacggctgatgcctgccaactttcagactat
ttcttcggttgtggaaaatttctggtcaatgggaggaactttccggtggagattgtatat
tccccttgtgacacagaggagacttctgttgttggcggcattgctacatatgttggtgat
gttgttaagatggctgtggaaatacataaaacagagaaagaaggaaccatccttgcattc
ttgacttcccaagccgaggtagaatgggcatgcgaaagatttatagctccatctgcagtt
gctttgcctttgcatggaaagctttcaatggaagaacaatttagggttttccagaaccat
cctgggaaacgaaaagtgatatttgccacaaatattgcagagacgtcactgactattcct
ggtgtcaagtatgtaattgattccgggatggtgaaagagagtaaatatgaaccgagaacg
ggtatgagcatcctcaaggtgtgccaggtcagtcagagttctgctcgacaacgtgctggt
cgtgctggaaggacagaacctggaagatgttacagactgtactcaaaaaacgattttgat
tcaatgagtcttaatcaggaacctgaaattcggagggtccatcttggtgtagcacttttg
aggattcttgctctgggtgtagacaacatagcagattttgactttgttgacgcacctgtc
ccggaagccattgcaatggctgtccaaaaccttgttcagctgggtgccgtcgtaaagaaa
aatggtgttcttgaattaacacaggaagggcattgtttagtcaagctgggtctggagcca
aagcttggaaagttaattttaggctgctttagatacagaatgggcaaagaggggattgtt
cttgctgctgtcatggctaatgccagtagtatattttgcagagttggcaacttcgatgat
aagatgaaagctgatcgcctaaaggtgcaattctgcaatcataatggagacctgttcact
cttctttcggtgtacaaagaatgggcatctctgccacgagagagaagaaataaatggtgc
tgggaaaatagcctgaatgccaaatcaatgagaagatgtgaagacacagtcaaggaactg
gagatatgcattgagagagaacttactcttgtcagtcctagttactgggtttggaatcca
agtgcgggtactaaacacgacaaacatttgaaaatggttatacttgcatctcttgcagaa
aatgtggcgatgtacactggctatgatcagcttggatatgaggtggcattgactggtcaa
caagttcagttacatccagcgtgttcattgctagcattcggccaaaagccaagctgggtt
gtttttggtgaacttctatcgattgtggaccagtacttggtatgtgtaactgcatttgat
tttgaggctttgtatacgcttgatccaccaccaccttttgatgcatctcagatggatgag
cggaggctccgagtgaaaaaagtggttggttgtagcagcactgtgctaaaacgattttgt
gggaaatctaatcgtagtctgctttcaattgtttctcgtgctaggtctctctgtaggaat
gaaaggatttgtattcaagtcgatgttgatcagaatgcgattctcctgtatgcgcctcca
ctcgacatggaaaaagtgtcagcccttgtgaacgatgcattggaatgtgaaaagaaatgg
atgcgtaatgaatgtttggagaagtatctatttcatggtcggggacaagtacctattgca
ctgtttggatctggtgctcaggtaaagcatcttgaagttgatcagagatttttgacagtc
gatgtactttattatggcgacaatgctgttgatgacagagagcttctgatgtttctggaa
aagaggattgatgggtgtatttgctctattcataagttttctgcaaacaaacaagactgt
gatgagaaggagaagtggggaagactaacctttctctcgcctgaatctgctatgaaggca
gcagaaattcagaaatttgatttcaatggatcagttcttaaattatttccatcgctgtca
actagtggaggaatgttcaagatgccttatttcccttccgtgacagctaagattctgtgg
ccgcgaagggaaagcactggtagaggatgtcttaagttcccttccggagatattcacagt
atatttggtgggatctccaaccttgagataggaacaaattctgctcatattcaaagagat
caaaagtccaatgattctatcttgataagtgggcttgacagtgatctttcggaagcagaa
gttttagatgttttggagttgaaaactgggattagagatctgaattttttcattttcaga
aaaaacagtgtgcagtgtccatctcctactgcttgcgaagaagagttgtataagagaata
tttgcgcatatgtcagcaaggaatccagagccaaactgtgtcaaagttcaagtttttgaa
ccaaaagaaaaagattatttcatgcgagcatatattacttttgacgggagatatcatttg
gaagctgcaaaagctttgcaggagttaaatggacaggtgctacctggatttcttccatgg
cagaagattaagtgtgaacaattgtttcagagctccatagtctgctcctcttctatctac
aacactgtcaaaagacagttgaatgttttattagcaagctttgagagacaacgagggggt
gactggcgtctggaaccaactcataacggtgcttatcgtgttaaaatttgtgcttatgca
acaagacccattgcagagatgcgaagagaacttgaagaactcgtaagaggaagacccata
aaccatccaggcttaacccctagagtcctgcagcatcttatgtccagagatggtattaat
ctgatgcggaagatccaacaggagactgaaacttacattgtattagacaggcacaatctc
acagtacgcatttgtggatcaagtcagaaaattgccgaggctgaacgagaactggttcag
tcacttgtggcttatcacgagagcaagcaacttgaaatccatctccgaggtcctgatatc
cgtcctgacctcatgaaggaagtggtgaggcggtttggtcccgagctccaaggtatcaaa
gaaaaggtacatggtgtggatctgaagctcaacacccggtaccatgttattcaggttcat
gggagcaaagaaatgagggaggaagtacaaaagatggtcaatgaacttgcacgagaagag
agtgcaatgggtgaaaaaccagatgacatagaagttgaatgccccatttgcttgtctgaa
gtcgaagatggctattctcttgaaggatgttcacatctcttctgcaaagcttgtttgttg
gagcaatttgaggcatcgatgagaaactttgacgcattcccaatactttgttctcacgtt
gactgtgaagctccaatagtactagctgatatgagagccctcttatcacaacagaagctc
gatgaactcttccgagcatccttgtcctcctttgtaacatctagcgacggaaagttccgg
ttttgctccacacctgattgcccttccgtctaccgtgtagctggacctcaagaatcggga
gagccattcatctgtggagcatgtaacgcagaaacatgcacaaggtgtcacctcgagtat
cacccgttaatcacatgtgaaaggtacaaactgttcaaggaaaatccggacttgtcgcta
caggactgggcaaaagggaaggatgtgaaggagtgtccgatttgcaagtgcacgatagag
aaaactgatgggtgtaaccatctgctgtgccgttgtggaaagcacatttgctggacttgc
ttagacgtcttcactcaagcagcatcttgttatgcccatttaaggacaattcatggcgga
atcggcggggttggtgatctcgtggatcttgatatccccttagcagagttcggttttcca
atcgatatccccaggccttga

DBGET integrated database retrieval system