KEGG   Camelina sativa (false flax): 104709734Help
Entry
104709734         CDS       T05044                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase NCED6, chloroplastic-like
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00906  Carotenoid biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
Module
csat_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    104709734
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     104709734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 104709734
NCBI-ProteinID: XP_010424600
Position
8
AA seq 229 aa AA seqDB search
MQHSLRSDLLRSKTSSSHSHLLPQTKNVNISRRVLINPFKITTLPDLPPLFKSPVTPPPV
KLKPTHPNLNPLQKLAASMLDKIESSIVIPMEQNRPLPKPTDPAVQLSGNFAPVQECPVQ
NGLEVVGQIPSCLRGVYVRNGANPMFPPLAGHHLFDGDGMIHAVSIGSDNKVSYSCRYTK
TNRLVEETKLGRSVFPKPIGELHGHSGLARLALFRRKKVEEDIKPGYFK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcaacactctcttcgttctgatcttcttcgttcgaagacttcttcttctcattctcat
ttacttccacaaaccaaaaatgtaaacatctcccgaagagttcttatcaaccctttcaag
ataacaacacttcctgatctccctcctctcttcaaatctccggtcacgccaccaccggtt
aagctcaaaccaacccatccaaacttaaaccctctccagaagctagcggcttcgatgctc
gacaagatagagtcctctatcgtcataccgatggagcagaatcgaccgcttcctaaaccg
accgatccagcggttcaattatcaggtaacttcgctccggttcaagaatgtccggttcaa
aacggtttagaagtcgttggtcagattccttcttgtctacgaggagtttacgtacgtaac
ggcgctaaccctatgtttccaccgttagccggacatcatttgtttgacggtgacggaatg
attcacgccgttagtatcggttctgataacaaggttagttacagctgtcggtacactaaa
acgaaccggcttgttgaagaaaccaagcttggaagatcggtttttcctaaaccaatcggc
gagcttcacggccattccggtctagctcgactcgctctcttccgccgcaaaaaagtggag
gaggatatcaaacctggctacttcaagtga

DBGET integrated database retrieval system