KEGG   Camelina sativa (false flax): 104710551Help
Entry
104710551         CDS       T05044                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase, cytoplasmic
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00030  Pentose phosphate pathway
csat00480  Glutathione metabolism
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01200  Carbon metabolism
Module
csat_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
csat_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    104710551
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104710551
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csat04147]
    104710551
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     104710551
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     104710551
Exosome [BR:csat04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   104710551
  Exosomal proteins of colorectal cancer cells
   104710551
  Exosomal proteins of bladder cancer cells
   104710551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 104710551
NCBI-ProteinID: XP_010425474
Position
9
AA seq 516 aa AA seqDB search
MGSGQWHVEKRSTLKNDSFVKEYNPVSETGSLSIIVLGASGDLAKKKTFPALFNLFHQGF
LSPDEVHIFGYARSKITDEELRDKIRGYLVDEKNASVKSDALSKFLKLIKYVSGPYDSEE
GFKRLDKAISEHEISKKTSEGSSRRLFYLALPPSVYPPVSKMIKAWCTNKSDLGGWTRIV
VEKPFGKDLESAEQLSSQIGALFEEPQIYRIDHYLGKELVQNMLVLRFANRLFLPLWNRD
NIANVQIVFREDFGTEGRGGYFDEYGIIRDIIQNHLLQVLCLVAMEKPISLKPEHIRDEK
VKVLQSVIPIKDEEVVLGQYEGYRDDPTVPNDSNTPTFATTILRIDNERWEGVPFILKAG
KAMSSKKADIRIQFKDVPGDIFKCQNQGRNEFVIRLQPSEAMYMKLTVKQPGLEMQTVQS
ELDLSYKQRYQGVSIPEAYERLILDTIRGDQQHFVRRDELKAAWEIFTPLLHRIDKGEVK
SIPYKQGSRGPAEADQLLKKAGYMQTHGYIWIPPTL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgggttctgggcaatggcatgttgagaagaggtctactttaaagaacgattcttttgtg
aaagaatacaatccagtctctgaaactgggagcctctccatcattgttcttggtgcttct
ggtgatcttgccaagaagaagacttttcctgcacttttcaatctattccaccagggattt
cttagtccagatgaagttcatatctttggatatgcaaggagtaagattactgatgaggaa
ctgagagataaaatccgcggctatcttgttgatgagaagaatgcatctgtgaaatcagat
gctttgtccaagtttcttaagctgattaagtatgtaagtggaccttatgattctgaggaa
gggtttaagagattagacaaggcgatttctgagcacgagatctctaaaaagacttctgaa
ggatcttccaggagattgttttatcttgcacttcctccgtctgtataccctcccgtaagc
aagatgatcaaggcatggtgcactaacaaatctgatcttggtggatggactaggatcgtt
gttgagaaaccatttggaaaggacctggaatctgctgagcaactgagttctcagattgga
gcgctgtttgaggaaccacagatttatcgtattgatcactatctgggaaaagaattagtg
caaaacatgttggttcttcggtttgccaatcgcttgtttttgccactatggaaccgcgac
aatattgcaaacgtacagatcgttttcagagaagattttggaactgaaggtcgcggggga
tattttgatgaatacggaatcattcgtgatattattcaaaaccacttgctccaggtactt
tgccttgtcgccatggagaaaccaatttctcttaagcccgagcatatccgggatgagaaa
gtgaaggttcttcaatctgtgatccccataaaagatgaagaggtggttcttggacagtat
gaaggatatagagatgatccaactgttccaaatgactcaaacactccaacgtttgccaca
acaattcttcgcatagacaatgaaagatgggaaggtgttccttttatactgaaggccgga
aaggcaatgagttcaaagaaggcagatattcgcattcagtttaaggatgttcctggcgac
atatttaaatgtcaaaaccaagggaggaacgagtttgttatacgcttgcagccttcagag
gccatgtacatgaagctaactgtgaagcaaccgggtctggagatgcaaactgtgcagagt
gaactagacctatcgtacaagcaacgttaccaaggtgtctcgattccagaggcttacgag
cgcctaattcttgacacaatcagaggtgaccaacaacactttgttcgcagagacgaattg
aaggcagcttgggaaatcttcactccactgcttcacaggatcgacaagggagaggtgaaa
tcgatcccatacaaacaaggaagccgtggtccagccgaagcagatcagctactgaagaaa
gctggttatatgcagacccatggctacatatggatccctcctacattgtaa

DBGET integrated database retrieval system