KEGG   Camelina sativa (false flax): 104711287Help
Entry
104711287         CDS       T05044                                 

Definition
(RefSeq) glycine--tRNA ligase, chloroplastic/mitochondrial 2-like
  KO
K14164  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:csat00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    104711287
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:csat03016]
    104711287
Enzymes [BR:csat01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     104711287
Transfer RNA biogenesis [BR:csat03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    104711287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA_synt_2f tRNA-synt_2e DALR_1
Motif
Other DBs
NCBI-GeneID: 104711287
NCBI-ProteinID: XP_019084802
Position
9
AA seq 1064 aa AA seqDB search
MAILTLSLPLIVSFLRPHASPRFFLLPRSLSHTPFLSRRRFHRTSASIHHQSYRKPDDDP
TTRAASVPTFQQAIQRLQEYWASVGCAVMQPSNTEVGAGTMNPCTFLRVLGPEPWNVAYV
EPSIRPDDSRYGENPNRLQRHTQFQVILKPDPGNSQQLFINSLSALGIDVTAHDIRFVED
NWESPVLGAWGLGWEIWMDGMEITQFTYFQQAGSLPLSPVSVEITYGLERIIMLLQEVDH
FKKILYADGITYGELFLENEKEMSSYYLEHASVDRLQKHFDYFDEEARSLLALGLPIPAY
DQLLKTSHAFNILDARGFIGVTERARYFGRMRSLARQCAQLWLKTRESLGHPLGVASESV
LPVCHREALEKVAEKVPEDPRSFIIEIGTEEMPPQDVINASEQLRVLVLELLENQRLRHG
AVKAFGTPRRLVVLVDAMSSRQLEEEVEVRGPPASKAFDDQGNPTKAADGFSRRHGVPLE
KLYRKVSGKTEYVHALVTEPARLALEVLSEDLPAMLAKISFPKSMRWNSSVMFSRPIRWV
MALHGGLVVPFSFAGISSGNVSCGLRNTASASLLVQNAESYEDTMRNSGINIEIEERKKI
ILEKSNALAKSVNGRLVVPQNLLNEVANLVEAPVPLIGKFKESFLELPEELLTIVMQKHQ
KYFSIIDDSGHLLPYFIAVANGAINEDVVKKGNEAVLRARYEDAKFFYEVDTRKRFSDFR
GQLQGILFHEKLGTMLDKMNRLQKMVTKLCLALEIDEDVLPVVEEAASLAMSDLATAVVT
EFTALSGIMARHYALRDGYSEQIAEALLEITLPKFSGDVIPKTDAGMVLAIADRLDSLVG
LFAAGCQPSSSNDPFGLRRISYGLVQILVEKDKNVNFKSALELAASVQPTKVEANTLEDV
YQFVTRRLEQLLVDNGVSPEVVRSVLAERGTYPCLAARTAHKMEKLSRGEMFPKIVEAYS
RPTRIVRGKDVGVGVEVDEKAFETTQERALWSTYTSIKDQIHTGIEIEEFTEISMQLVEP
LEDFFNNVFVMVEDERVRKNRLALLNNIANLPKGVIDLSFLPGF
NT seq 3195 nt NT seq  +upstreamnt  +downstreamnt
atggccatcctcactctttctcttcctcttatcgtctctttccttcgtcctcacgcttct
cctcgcttcttcctcctccctcgctctctctcccataccccttttctctcccgccgccga
tttcaccgcacctccgcctctattcaccaccagtcctatcgtaagcccgacgatgatccc
accacccgcgccgcgtctgttcctacattccaacaggcgattcaacgcctccaggaatat
tgggcttccgttggatgcgccgttatgcaacctagtaacactgaggtaggagctggcacc
atgaatccttgtacctttttgagggttcttggtcctgaaccttggaatgttgcatatgtt
gagccaagcatacgtcctgatgattctcgctatggtgagaaccccaataggcttcaaaga
catactcagtttcaggtcattttgaaacctgaccctggaaactctcaacagctctttatc
aacagtctctctgctttaggtattgatgtgactgcacacgatattcggtttgtagaagat
aactgggagagtccggtgcttggtgcgtggggtttgggttgggagatttggatggatggt
atggaaatcacacaatttacttacttccagcaggctggaagtcttccgttgtctccagta
tctgttgaaataacttatgggcttgagcgcatcatcatgttgcttcaggaagttgatcat
tttaaaaagatcttatatgctgatggtatcacctatggggagcttttcttggaaaacgag
aaggaaatgagctcatattatttagagcatgctagcgtggatcgccttcaaaagcatttt
gattattttgatgaagaagcacgttccttgcttgccttaggacttccaatccctgcgtat
gaccagcttctgaagacgtctcacgcttttaacattttagacgccagaggtttcattggc
gtaactgaacgtgctcgttatttcggtcgaatgcgcagcttggctcgccaatgtgcccag
ttgtggttaaagacacgcgagtctcttggacatcctcttggtgttgcctccgaatcagtt
cttcccgtttgtcaccgagaggctttggaaaaagtggctgaaaaggttcctgaggatcca
agatcgtttattattgagatagggactgaagagatgccacctcaagatgttatcaacgct
agtgaacaactcagggtcttagtgctagaattactagagaatcaaagattgcggcatggt
gctgtgaaagcatttggcacacctcgcaggctagtggttttagttgatgctatgtcctcg
aggcagctggaagaggaggttgaagttcgaggaccccctgcttccaaagcttttgatgat
caaggaaatcctacgaaggctgcagatggttttagccgtagacatggcgttcctttggaa
aaattgtacagaaaagtttctgggaagacagaatatgtccatgcactagttacagagcca
gctcgacttgctttggaggttctatcagaagatttacctgctatgctggctaaaatatcg
ttcccaaagtcaatgcgctggaactcttcagtaatgtttagcaggccaattcgctgggtt
atggccttacatgggggtctggttgtgccattctcctttgctggcatctcaagtggaaat
gtatcttgtggacttcgcaatactgcttcagcatcactattggtacagaatgcagaatcc
tatgaagatactatgaggaattctggaatcaatattgaaattgaggaaaggaagaaaatc
attcttgagaagtcaaatgcactagcaaagagtgtgaatggacgccttgttgtcccacag
aacttacttaacgaggttgcaaatctcgtcgaagctcctgtgcccttaatcggaaagttc
aaggaatcattcttagaacttccggaggagctattaactattgttatgcagaagcaccag
aagtatttttccattattgatgatagtggacatctattgccttactttattgctgttgcc
aatggtgcaataaatgaggacgtggtgaagaaaggaaatgaagcagttctcagggcacgt
tatgaagatgcaaagttcttttatgaggtggacacaaggaaaaggttttctgatttccga
ggtcagctgcagggaattctcttccatgaaaagctggggacgatgctggataagatgaac
cgtctacaaaagatggtaactaagctttgtttggccctcgaaattgatgaagatgtgctt
cctgtcgtggaggaggctgcctctcttgctatgtcagaccttgcaactgctgtagttaca
gaatttactgcgctgtcaggaataatggctcgccattatgctctcagagatggctattca
gagcagatagcagaggctttgctggagattacacttcctaaattttctggagatgtcatc
ccaaaaacagatgcaggaatggttttggcaatagctgatagattagatagccttgttggt
ctatttgctgctggttgccagccaagttcatcaaatgacccatttggccttagaagaata
tcatatggcttagttcagattttggtcgagaaggataaaaatgtcaacttcaaaagtgct
ctagaacttgcggccagtgtacaaccaacgaaggttgaggcaaacactttagaagatgtg
tatcaatttgttactcgaagactggaacagctactggttgacaacggagtaagccctgaa
gtagttaggtctgtcctagcagagcgtggaacctatccttgtctggcagcgcgtactgca
cacaagatggaaaagctaagcagaggtgagatgtttccgaagatagtggaagcatattct
cgtcccacacgcattgtccgtgggaaagacgttggtgttggagttgaggtggatgagaag
gcatttgagactacccaagagagagcattgtggagcacttacacctctatcaaagatcaa
attcacactggtatagaaatcgaggagttcactgagatatcgatgcaattggtggagcca
ctcgaggatttcttcaacaatgtgtttgtgatggtggaagatgaaagagtgaggaagaac
agactcgctctgctcaataacattgctaatcttcccaaaggagtcattgacctttcattt
ttgcccggattttga

DBGET integrated database retrieval system