KEGG   Camelina sativa (false flax): 104711853
Entry
104711853         CDS       T05044                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00100  Steroid biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
Module
csat_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    104711853
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     104711853
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 OPA3
Other DBs
NCBI-GeneID: 104711853
NCBI-ProteinID: XP_019084851
Position
9
AA seq 373 aa
MLLDMDLGVLLPSLIPSSQSVYVLVFYFVYLAVAGEILPGKVIRGVLLSDGSQLRYRCNG
LLALTLLVAILGICAKLGIVSPLVVADRGLELLSATFIFCVLVTLVLYITGRSSSDKSSS
LKPHVSGNLVHDWWFGIQLNPQFMSIDLKFFFVRAGMMGWLLINLSILAKSVQDSSLSQS
MILYQIFCALYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLLWIPFTFSIQGWWLLHNK
VELTVPAIVANCLVFVIGYLVFRGANKQKHIFKKNPKTPIWGKPPVVVGGKLLASGYWGI
ARHCNYLGDLMLALSFSLPCGISSPVPYFYPTYLLILLIWRERRDEVRCAEKYKEIWAEY
LRLVPWRILPYVY
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgctcctagatatggatctcggtgttcttctaccatctcttattccatcatcgcaatct
gtttatgtgctggtgttctacttcgtttacttggccgtcgccggtgaaattctccccggg
aaagttattcgcggcgttcttttatctgatggctctcaacttcgttaccgatgcaatggt
ctattggcgttaacattgttggtcgctattttgggaatctgtgcaaaacttggcattgta
tcacctcttgtggttgccgatagaggacttgagttactctctgctacttttattttctgt
gttttggtgacactagtattgtatattactgggagaagttcctcggataagagttcttcc
ctaaagcctcatgtctcaggaaatcttgtacatgactggtggtttggaattcagctgaat
cctcagtttatgagcatcgatctcaagtttttctttgtcagagccgggatgatgggatgg
ctgcttatcaatctctctattctggcaaaaagtgtgcaggatagttcactgagtcagtcg
atgattctttaccagatcttctgtgcgttatatatattggactactttgttcatgaagaa
tacatgacctctacgtgggacataattgcagagagactgggcttcatgctagtgtttgga
gatctcttatggattcctttcacttttagcattcagggctggtggcttttgcacaacaaa
gtagaacttacagttcctgctattgtagccaattgccttgtcttcgtgatagggtacttg
gtttttcgaggggctaacaaacaaaaacatatctttaagaagaacccaaaaacgcctata
tggggcaagcctccagtggtagttggtggaaagttactggcttcaggctattggggaatt
gcaaggcactgtaattaccttggcgacttgatgcttgctctctccttcagtttgccctgt
ggaataagttctccagttccatatttctacccaacatatcttctgatactgttgatatgg
agagaacgaagagacgaggttagatgcgcagagaagtacaaggagatatgggcagagtat
cttagactagtcccctggagaatacttccttacgtgtattag

DBGET integrated database retrieval system