KEGG   Camelina sativa (false flax): 104712018Help
Entry
104712018         CDS       T05044                                 

Definition
(RefSeq) probable apyrase 3
  KO
K01510  apyrase [EC:3.6.1.5]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00230  Purine metabolism
csat00240  Pyrimidine metabolism
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104712018
   00240 Pyrimidine metabolism
    104712018
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:csat04090]
    104712018
Enzymes [BR:csat01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     104712018
CD molecules [BR:csat04090]
 Proteins
  104712018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39 Glyco_hydro_42C NiFe_hyd_3_EhaA
Motif
Other DBs
NCBI-GeneID: 104712018
NCBI-ProteinID: XP_010427113
Position
9
AA seq 490 aa AA seqDB search
MEPEMDALKVPILPEHQSSSPTPWSSRLTKRIIIPTAVSGALALGIFSFFLNFNSAPVPV
PLPGSLYSVIIDAGSSGSRVHVFKYSIDQSGAPVYSFGPDHHKVSRFLGGLSTYANNLEG
AKEKVEQLVGFAKEIVPQDMWSRTDIRLMATAGMRAIAKTDQESILNTAKQVFRSRPGFH
FRDEWAYVISGSDEGLYAWIIANHALGLLGNTGTTGIVELGGASAQVTFELSNQQVNSVD
SHMKTCNSFPYRIYSHSFPNYGKDAALKRLMDNLQYPDGEEVEEDVEDPCTPQGYTYQNN
RRKYLSVFLADESEYTRLVAAGNFARCKIKTLELLQEGNEMCPSNSCAIGSTYTPPVQGR
FLATSNFAYTSEFFHLNELNWMSDLRQKGEEFCQKTWEALELEYRGTLNYSEEYLRGYCF
SSAYIIAMLERLGFNDESTIEFSNEVHGTSLDWALGAFIDSFSQPSIAPAPSPALTSGHS
GGDSRKFLGF
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaaccggagatggatgccctcaaggttccgattctacctgagcaccaatcatcatct
ccgactccatggtcgtcgagactcacgaaacggattatcataccaaccgccgtttcgggg
gctctagcgttagggatattttccttcttcttgaattttaattcagctccagttccagtt
ccattacccggaagtttgtacagcgtcattatcgatgctgggagttcggggtcccgagtt
cacgtgttcaagtactccattgatcagtccggggcacccgtttacagttttggtcctgac
caccacaaggtgtctaggtttctaggtggtttgtcgacgtatgctaataatctggaagga
gcgaaggagaaagtggagcaacttgtgggcttcgccaaggaaattgttccccaggatatg
tggagcaggactgacataaggttaatggcaactgctgggatgagagccattgcgaaaact
gatcaggaaagtattcttaatactgccaaacaagtttttagatctcgtcctgggtttcat
tttcgtgacgagtgggcttatgttatcagtggatctgatgaaggtttatatgcttggata
attgccaatcacgcactcggtttgcttggaaatactgggacaacggggattgttgaactc
ggcggggcttctgcgcaggtgacctttgagttaagtaatcagcaagtgaattctgtggac
tcgcatatgaaaacctgtaacagttttccatacagaatctacagtcacagcttccccaac
tatgggaaggatgcagcactaaaaaggttaatggataatctacaatacccagacggggag
gaagtggaggaagacgttgaagacccttgtactcctcaagggtacacctaccaaaataat
cggcgtaaatatctatccgtattcctagctgatgaaagcgaatatacaagacttgtagct
gctggtaatttcgcaagatgcaaaatcaaaacgcttgaacttttgcaggaaggaaatgag
atgtgtccatctaattcgtgtgctattggatctacatacacacctccggttcaaggaagg
tttttggctacatcaaattttgcctacacaagcgaattctttcacttaaacgaactaaat
tggatgtctgacttaaggcaaaagggggaggagttttgtcaaaaaacctgggaagcacta
gaactggaatacagaggtactctaaactatagtgaagaatatttgcgtgggtattgcttc
tcatcagcatatataatcgcaatgcttgaaaggcttggttttaatgacgaaagtactata
gagttttcgaatgaagtacatggcacatcattagattgggcattgggcgctttcatcgat
agtttctcacagcctagtatcgcccctgctccaagtcccgcactcacttctggtcacagt
ggtggtgattctagaaaatttcttggcttttga

DBGET integrated database retrieval system