KEGG   Camelina sativa (false flax): 104712793Help
Entry
104712793         CDS       T05044                                 

Definition
(RefSeq) probable sucrose-phosphatase 2
  KO
K07024  sucrose-6-phosphatase [EC:3.1.3.24]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    104712793
Enzymes [BR:csat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.24  sucrose-phosphate phosphatase
     104712793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: S6PP S6PP_C Hydrolase_3 Trehalose_PPase PMM IL6Ra-bind DUF1977 RHSP DUF2608
Motif
Other DBs
NCBI-GeneID: 104712793
NCBI-ProteinID: XP_010428066
Position
9
AA seq 235 aa AA seqDB search
MVPDHGWVDTLKNHKWDLGIVKEEACKFSELKLQAETEQRPHKVSFYVDKSKAQEVTKEL
SRRFEKRGLDVKIIYSGGMDLDILPQGAGKGQALAYLLKKLKTEGKLSVNTLACGDSRND
AELFSIPDVYGVMVSNAQEELLKWHAENAKDNPKVIHAKERCASGIIEAIGHFKLGPNLS
PRDVSDFLECKTENVNLGHEVVKFFLFYERWRRGEVENCEAYTASLKASCVSIVT
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggttcctgatcatggttgggttgatactttgaagaaccataaatgggatttgggtatt
gtcaaagaagaagcttgcaagttttctgagttgaagcttcaggctgaaactgagcagagg
ccacacaaggttagcttttatgttgataagagtaaggctcaggaagttactaaggagtta
tcacgacggtttgagaaacgtgggttggatgtcaaaatcatttacagtggaggtatggat
ttggatattttaccacaaggtgctggaaagggacaagcgcttgcgtatctgcttaagaag
ctgaagactgaaggaaagctctctgttaatactcttgcttgtggcgactcaagaaacgat
gctgaactgtttagcattcctgatgtttatggcgtcatggtaagcaatgctcaagaagag
ctgttgaagtggcatgctgaaaatgcaaaagacaacccaaaagtgatccatgcaaaggag
aggtgtgcaagtgggattatagaagccattggtcacttcaagcttggtccaaacctttct
ccaagggatgtctctgacttcttagagtgcaagacggagaatgtgaacctcggtcacgag
gttgtgaagttctttttgttctatgagagatggagacggggtgaggttgagaactgtgag
gcgtacactgctagcctcaaagcttcatgtgtaagtattgtaacatag

DBGET integrated database retrieval system