KEGG   Camelina sativa (false flax): 104713937Help
Entry
104713937         CDS       T05044                                 

Definition
(RefSeq) insulin-degrading enzyme-like 2 isoform X1
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:csat01002]
    104713937
Enzymes [BR:csat01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     104713937
Peptidases and inhibitors [BR:csat01002]
 Metallo peptidases
  Family M16: pitrilysin family
   104713937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16_C Peptidase_M16 CSS-motif
Motif
Other DBs
NCBI-GeneID: 104713937
NCBI-ProteinID: XP_010429468
Position
9
AA seq 973 aa AA seqDB search
MAVGTETTTVTVDRGDEILKPRTDKRDYRRILLKNSLEVLLISDPETDKCAASMNVSVGS
FSDPDGLEGLAHFLEHMLFYASEKYPEEDSYSKYITEHGGSTNAYTASEYTNYHFDINTD
SFDEALDRFAQFFIKPLMSADATMREIKAVDSENQKNLLSDPWRMHQLKKHLSRENHPYH
KFNTGNMDTLHVRPESKGIDTRSELIKFYDEYYSANIMHLVVYGKESLDKTQGLVEELFQ
EIPNTNKDIPRFPGQPCTPDHLQVLVKAVPIRQGHKLTVYWPITPSIHHYEEAPARYISR
LLGHEGEGSLFHALKILGWATGLYAGEADWTTEYSFFNVTINLTDAGHEHMEDILGLLFR
QIKHLQQSGVSQWIFDELSAICEAEFHYQAKIHPISYATRISPKMTIYPREHWLVGSSLP
TKFNPASVEKVLNELSPNNVRIFWESNKFEGQTDKVEPWYNTAYSLEKITKLTIQEWVQS
ALYVNLLLPTPNVFIPTDFSLKVFKDKDTFPVLLRETSFSRLWYKPDTKFFKPKAYVKMD
FNCPLAVTSPVAVVLSNFFVWLLVDYLNEYAYYARIAGLQYGISLSDNGFELYLVGFNHK
LRVLLEAVIQKIAKFQVKPDRFSVIKETVTKAYQNHKFGQPYHQAMSYCSMVLQDHSWPW
TEELDALTYLEVEDLAKFVPMLLSRTFVECYIAGNVEKSEAESMVKHVEDVLFNDPKPIC
RPLFPSQFLTNRVTDLKTGMKYFYHQQGTNPNDENSALVHYIQVHQDEFSMNIKLQMFKL
IAKQATFHQLRTVEQLGYITSLSQRNDSRVYGVQFIIQSSVKGPGHIDMRVESLLKDLES
KLYNISDEEFKSYVTALIDMKLEKHKNLSEESGFYWGEIQDGTLKFNRIDVEVAALKELK
KEELIDFFNEYIKVDAPKKKSLSVCVYGNQHSKEMASDKDKVVSPFVEIEDIVGFRNSLP
RYGSLRGCSQLKL
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atggctgttggaacggagaccacgacggtgacggtggatcgaggtgacgagatactaaag
ccacgcactgacaagagagactatcggaggattttacttaagaattcgctcgaggtgttg
ttaatcagcgacccggagactgacaagtgtgctgcttcaatgaacgttagcgtcggatcg
ttctctgacccagatggattggaaggcctagctcatttccttgagcatatgctattttat
gcaagtgaaaaataccccgaggaagatagttactccaagtacatcacagagcatggaggg
agtacaaatgcttatacagccagtgaatatacaaattaccatttcgatatcaacacagat
tcttttgatgaagctttggacaggtttgcacagttctttatcaaaccactgatgtctgct
gatgcaaccatgagagagatcaaagctgtcgactctgagaatcagaaaaacttgttgtct
gatccttggcgtatgcaccagttaaagaagcatctaagtcgggaaaaccatccatatcac
aaatttaacacaggtaacatggatactcttcatgtacgacccgaatcaaaaggaatagat
acgaggagtgaactaattaaattctatgatgaatactattctgcgaacattatgcatctg
gttgtatatggcaaggaaagccttgataaaactcaaggcctagtggaagagttgttccag
gaaattccaaacaccaacaaggatatccctaggtttcctggtcagccttgtactcctgac
catttgcaggtacttgtgaaggcagttcccataaggcaaggtcacaagcttactgtttac
tggcctataactcctagcatccatcattatgaagaagcaccagccaggtacattagtcgt
ctacttggtcatgaaggcgaaggaagtttgtttcatgcgttaaaaatcttgggttgggca
acgggactgtatgctggcgaagcagactggactacggagtattctttcttcaatgttaca
attaatcttactgatgctggccatgaacatatggaagatattttgggattgttgtttaga
cagattaagcatttacaacagtctggtgtttcccagtggattttcgatgagctctcagct
atctgtgaggcagaatttcattatcaagccaaaatacacccaatttcgtatgcaacacgt
atttcaccaaaaatgacgatatacccaagggagcattggctggttggatcatcacttcct
acgaagttcaatccagctagtgtggaaaaggttctcaatgagctttctcccaataatgtt
cgaatcttttgggaatcaaataaatttgaagggcaaacagacaaggttgagccatggtat
aacactgcttattctcttgaaaagataaccaaactcaccatccaggagtgggttcagtct
gccctttatgtaaacctccttctaccaacacctaacgtcttcattcctacggatttttca
ttgaaggtttttaaggataaggataccttccctgttttgttgagagagacatcattctca
agattgtggtataagcctgatacaaagttcttcaaaccgaaggcttatgtaaagatggat
tttaactgcccccttgcagtcacctctcctgttgctgtagttctttcaaacttttttgtt
tggttgctggtggactatttgaatgaatatgcttattatgctcgaattgctggtcttcaa
tatggaataagtctttcggacaatggttttgagctatatcttgttggctttaatcacaaa
ttgagagtcttgctggaagctgtcattcaaaagatagcaaaattccaagtaaaacctgac
aggttttcagttattaaggaaacggtcacaaaggcataccaaaatcacaaattcggacaa
ccatatcatcaagcaatgagttactgctcaatggtattacaagatcactcttggccttgg
acagaggaactagatgcacttacttatttggaagtggaagatttggcaaagttcgttcct
atgttgttatcaaggacatttgttgagtgctatattgcaggaaatgttgagaagagcgaa
gctgagtcaatggtgaagcatgttgaagatgttctctttaacgacccaaaacctatttgt
cgtcccttatttccatctcagttcttgacaaatagggttacagatctcaaaacaggaatg
aaatacttctaccatcaacaaggcacaaaccccaacgatgaaaattctgctctagtccat
tacattcaggttcatcaagatgagttttccatgaatatcaaacttcaaatgtttaaactt
attgcaaagcaagccacttttcaccagcttagaacggttgagcaacttggttacatcact
tcactctctcaaagaaacgactctcgtgtctatggtgtacagttcattatccagtcttca
gtcaagggtcctggacatatagatatgagggtcgagtcactactcaaagaccttgagagt
aagctttacaatattagcgatgaagaattcaagagctatgtaacagcgttgatagatatg
aagcttgaaaaacacaagaacttgagtgaggaatccgggttttactggggagagattcaa
gacgggacactcaaatttaaccgcatagacgtagaggtggctgcactgaaagagctaaag
aaagaagaactaatagatttcttcaacgaatacataaaggttgacgcaccaaaaaagaaa
tcgttgagtgtatgcgtttacggaaaccaacattcaaaggaaatggcatctgacaaagac
aaagttgtatcaccatttgtagaaatcgaagacattgttggtttcagaaactctctacct
cgttatggatcgttgagaggatgtagccagctgaaactgtga

DBGET integrated database retrieval system