KEGG   Camelina sativa (false flax): 104714239Help
Entry
104714239         CDS       T05044                                 

Definition
(RefSeq) ent-kaur-16-ene synthase, chloroplastic-like
  KO
K04121  ent-kaurene synthase [EC:4.2.3.19]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00904  Diterpenoid biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    104714239
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.19  ent-kaurene synthase
     104714239
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C YPEB
Motif
Other DBs
NCBI-GeneID: 104714239
NCBI-ProteinID: XP_010429829
Position
9
AA seq 179 aa AA seqDB search
MLREAEWSSNESTPSLEDYMKNAYISFALGPIILPATYLIGPPLSEKTVDSHQYNQLYKL
VSTMGRLLNDIQGFKRECKEGKLNAVSLHMEHERNSRSKDEIIESMKGLAERKREELHKL
VLEEKGSVVPRECKEVFLKMSKVLNLFYRKDDGFTSHNLMSVVKSVIYEPITLQDESLT
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgttgagagaagccgagtggtctagtaacgagtcaacaccaagcttggaggattacatg
aaaaatgcgtacatatcatttgcattaggaccaattattctcccagctacttatctgatc
ggaccaccactttccgagaagacagtggatagccaccaatataatcagctctacaagctc
gtgagcaccatgggtcgtcttcttaatgacatacaaggttttaagagagaatgcaaggag
gggaagctgaatgcggtttcattgcacatggaacacgagagaaacagtcgcagcaaagac
gagatcattgaatcgatgaaaggtttagcagagagaaagagggaagaattgcataagcta
gttttggaggagaagggaagtgtagttccaagggaatgcaaagaagtgtttttgaagatg
agcaaagtattgaacttattttacaggaaggatgatggattcacatcacataatctgatg
agtgttgttaaatctgtgatctacgagccaattaccttgcaggacgaatctttaacttga

DBGET integrated database retrieval system