KEGG   Camelina sativa (false flax): 104714602Help
Entry
104714602         CDS       T05044                                 

Definition
(RefSeq) acid beta-fructofuranosidase 3, vacuolar-like isoform X1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00052  Galactose metabolism
csat00500  Starch and sucrose metabolism
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104714602
   00500 Starch and sucrose metabolism
    104714602
Enzymes [BR:csat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104714602
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 104714602
NCBI-ProteinID: XP_010430330
Position
9
AA seq 643 aa AA seqDB search
MASSEALLLPVTYPQDPLSKSRSDRIPETSRRRPIKVLIAVFSSLILIALYVALTDTHEG
SNDETATESRASLAGVSEKDNERFWRVSGRKRETFPWNDTMLSWQHTVFHFQPEKHWMND
PNGPLFYKGWYHFFYQHNPYGTVWGNIVWGHAVSKDLIHWLYLPIAMVPDQWYDVNGVIT
GSATFLDDGSIVMLYTGITGEFVQVQNLAYPEDPSDPLLLKWVKFSGNPILLPPPGIGAK
DFRDPTTAWKTSAGKWRIVIGSKINRTGVSLVYDTTDFKTYELLDTLLHQVPNTGEWECV
DFYPVSKTEAIGLDTSVKGRDVKHVVKASMDDTRMDLYAIGTYFDSNATWIPDNPSIDVG
ISTALRYDYGTFYASKTFYDQNKGRRVLWGFTIESDTVAADQQKGWASVQTIPRTVVLDT
KTGKNLILWPVEEIESLRLSSKRFNMTVGPGTVVPVDVGSASQLDIEAEFVIKKDDLEIN
LGDNSAVGYDEDFSCEANGGSTVRGALGPFGFSVLADQSLSEHTPVYFYVTKGKDSKLKT
FFCTDNLRSTMANDVVTSIYGSLVPVLKGEKLTMRILVDHSMIEGFGQGGRTCITSRAYP
TKAIYGATKLFLFNNAIDASVTASFTVWQMISAFLHPYFADDL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggctagctccgaagctctcctcttgcccgtaacctacccacaagatccactatccaaa
tcaagatctgaccggatccccgagaccagccggagaagacccatcaaagtacttatcgcc
gtcttttccagtttgatcttgatagctttgtacgttgctctcaccgacacacacgaaggt
tccaatgatgaaacagcgacggagtcacgtgctagtttggccggtgtatcggagaaggac
aacgaacggttttggagagtttctggtcggaaaagggaaacgttcccgtggaatgatact
atgttgtcgtggcaacacacggtgtttcatttccagcctgagaaacattggatgaacgat
cctaatggtccgttgttctataagggatggtaccatttcttctaccaacacaacccatat
ggaaccgtatggggtaacattgtttggggtcacgccgtgtcaaaggaccttattcactgg
ctttacctcccaatagccatggttcctgaccaatggtacgacgttaatggcgttataacc
ggttcagccactttccttgatgatggctccattgtcatgctctacaccggtatcacgggc
gaatttgtacaggttcaaaaccttgcttatcctgaggaccctagcgacccccttttgttg
aaatgggttaagttctccggcaacccgattctgttacctcctccaggtattggcgcaaag
gacttccgtgacccgacaacggcatggaaaacatcagccggaaaatggcggatcgtcatc
ggctccaaaatcaatagaactggagtgtctcttgtttacgacactacagatttcaaaacc
tacgagctacttgataccttgctgcaccaagtccccaacaccggagagtgggagtgcgtt
gacttttacccggtgtcgaagactgaagccattgggcttgacacttcagtcaagggacga
gacgtgaagcatgtcgtgaaggctagcatggacgatactagaatggacctttatgccatt
ggaacgtattttgattcaaacgctacatggatcccagataacccttctatcgatgtcgga
attagtaccgctttgagatacgattacgggacattttatgcatcaaagacgttttacgat
caaaataagggacgcagagtcttatggggtttcaccattgaatctgacactgtagctgct
gatcaacagaagggttgggcttctgttcagaccattccaagaactgttgttttggacacg
aagacagggaagaacctaatcctatggccagttgaggaaattgaatcactgagactgagc
agcaagagattcaacatgacggttggaccagggacggtggtcccggttgatgtgggctct
gcctctcagctagatatagaggccgagttcgtgatcaagaaggatgatctcgaaataaac
cttggagacaactccgcggtgggctacgacgaggactttagctgcgaagccaatggaggc
tccaccgtgcgtggggctttaggacctttcggattctctgttctcgctgaccaaagcttg
tcggaacacacaccggtttacttttacgtgactaaaggaaaagattcaaaactcaaaact
ttcttctgcactgataacttaaggtcgaccatggcaaacgatgtagtgacatcgatctat
gggagtttagtacccgtcctaaaaggagagaaattgaccatgagaatcttggtggaccat
tcgatgatagaaggattcggacaaggtggaagaacatgtattacctcaagagcatatccg
acaaaagccatctatggagctacaaaactcttcttgttcaataacgctattgatgcgtcc
gttacggcgtcgtttacggtctggcaaatgatcagtgcttttctacatccttacttcgca
gacgatctttga

DBGET integrated database retrieval system