KEGG   Camelina sativa (false flax): 104722978Help
Entry
104722978         CDS       T05044                                 

Definition
(RefSeq) tripeptidyl-peptidase 2-like
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:csat01002]
    104722978
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:csat03110]
    104722978
Enzymes [BR:csat01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     104722978
Peptidases and inhibitors [BR:csat01002]
 Serine peptidases
  Family S8: subtilisin family
   104722978
Chaperones and folding catalysts [BR:csat03110]
 Intramolecular chaperones
  Subtilisin family
   104722978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII Prp19
Motif
Other DBs
NCBI-GeneID: 104722978
NCBI-ProteinID: XP_010439561
Position
11
AA seq 1387 aa AA seqDB search
MDLSLQLLQVHGPSCPSYWASSSSSSSSSSSSSSSSLSRPLDFIISSSSSPFLLHRRLKL
FGRRSCSRFRGIRLRRSGSLAMPCSSSENLTASRVGCGGGGGVGGGGGAENASVANFKLN
ESTFLASLMPKKEIRADRFVEDHPEYDGRGVVIAIFDSGFDPSAAGLHVTSDGKPKVLDV
IDCTGSGDIDTSTVVKADEDGHIRGASGVPLVVNSSWKNPTGEWRVGCKLVYQLFTDDLT
SRVKKERRKNWDEKNQEEIAKALKNLYDFDQKHSKVEDTKLKKTREDLQSKVDFLKKQAD
KYEDKGPVIDAVVWHDGEVWRVALDTQSLEEDPDCGKLADFSPLTNYRIERKYGVFSRLD
ACSFVANVYDEGKVLSIVTDSSPHGTHVAGIATAHHPEEHLLNGVAPGAQIISCKIGDSR
LGSMETGTGLSRALIAALEHKCDLVNMSYGEPALLPDYGRFVDLVTEAVNKRRLIFVSSA
GNSGPALTTVGAPGGTTSSIIGVGAYVSPAMAAGAHSVVEPPSEGLEYTWSSRGPTSDGD
LGVCISAPGGAVAPVPTWTLQRRMLMNGTSMASPSACGAIALLLSAMKAEGIPVSPYTVR
RALENTSTPVGDLPEDKLTTGQGLMQVDKAYEYLKKFQDCPCVNYQIKVNLSGKTIPTSR
GIYLREGTACRQSTEWTVQVDPKFHEGASNLKELVPFEECLELHTTDEGVVRVPDYLLLT
HNGRSFNVVVDPTNLGYGVHYFEVYGIDCKAPERGPLFRIPVTIIIPETVANRPPVISFP
QMSFISGHIERRFIEVPHGATWAEATMRTSGFDTTRRFYIDTLQLCPLRRPIKWESASTF
ASPSAKSFTFPVFSGQTMELAIAQFWSSGLGSREPTIVDFEIAFHGIGVDKEELLLDGSE
APIKVEAEALLASEKLVPIAVLNKIRVPYQPIDAQLKTLSTSRDRLLSGKQILALTLTYK
FKLEDAAEVKPYIPLLNNRIYDTKFESQFYMISDANKRVYATGDVYPESSKLPKGEYKLQ
LYLRHENVQLLEKLKQLILFIERNVGEVRLNLHSEPDGPVTGNGAFKSSLLMPGYFFFWL
TYQFKLNSPQGSVLVGEISYGKLSFDDKEGKNPKDNPVSYPISYVVPPNKPDEDKKASSA
SNCSKSVSERLEQEVRDTKIKFLGSLKQETEEERSEWRKLCACLKSEYPNYTPLLAKILE
GLLSRSDAGDKISHHEEIIEAANEVVRSVDEDELARFLQQKSEPEDEEAEILKKKMEMTR
DQLTEALYQKGLAMARIENLKGEKGDEGEEESSQKDKFEENFKELTKWVDVKSSKFGTLT
VLREKRLSRLGTALKVLDDLIQNESEIANKKLYELKLGLLEELGWSHLVTYEKQWMQVRF
PTSLPLF
NT seq 4164 nt NT seq  +upstreamnt  +downstreamnt
atggatctgagtctgcagttgctgcaggttcacggcccgtcgtgtccttcttattgggct
tcttcttcttcttcttcttcttcttcttcttcttcttcttcttcttcactctctcgtcct
cttgatttcatcatttcctcttcttcatcaccgtttcttcttcatcgaagactcaaattg
ttcggaagaagaagctgctctcgttttcgtggaatccgattaagaaggagtggttccctg
gcgatgccttgttcttcttctgagaatcttacggcttctcgcgtcggttgtggcggagga
ggtggtgttggtggtggtggtggagctgagaatgcttctgtcgctaatttcaagctgaac
gagtctactttccttgcttctctcatgcctaagaaagaaatccgtgcggatcgcttcgtt
gaagatcatcctgagtacgacggtcgtggcgtcgttatcgctatctttgattctggtttt
gatccttctgctgctggcttgcatgtaacttctgatgggaaacctaaggttctggacgtc
attgactgcactggaagtggggatatagatacatccacagtggtgaaagccgatgaagat
ggtcatattcgtggagcatcaggggtacctttggttgtcaattcttcatggaaaaacccc
acaggagagtggcgcgtaggttgcaagttggtttaccagctatttacagatgacttaact
tctcgtgtcaagaaagagagaaggaaaaactgggatgaaaagaatcaggaagaaattgca
aaggctttaaagaatctgtatgattttgatcagaagcacagcaaggtggaagatacgaaa
ttgaagaagacccgtgaagacctccaaagcaaagttgattttctgaaaaaacaagctgat
aaatatgaagacaaagggcctgttattgatgctgttgtgtggcatgatggagaagtatgg
agggttgcacttgatacgcagagtctggaagaggatccagattgcgggaaactagcagac
ttctcccctctaacaaactatcgaattgagcggaagtatggcgtgtttagccgactagat
gcatgctcctttgttgctaacgtgtatgatgagggaaaggtcctaagcattgtaactgat
agttctcctcatggcacccatgttgctggaatagctactgcacaccaccctgaggagcat
ttgttaaatggtgtagcacctggtgcacaaataatatcttgcaaaattggagactcgcgg
ttaggttcaatggagaccggaactggtttgtcacgggcattgatagctgccctggagcat
aaatgtgatcttgtcaacatgagctatggagagccagcattacttccagactatgggcgc
tttgttgatcttgttactgaagccgtgaacaagagacgcctaatatttgtaagtagtgct
ggcaacagtggtccagctttgacaacagtcggagcaccgggtggaacaacttccagtatc
attggtgttggtgcatatgtttctcctgcaatggcagctggtgcccattcagtagtggaa
cctcccagcgaggggcttgaatacacttggtcaagccgggggccaacatctgatggggat
cttggtgtctgcataagtgcacctggtggggctgttgctcctgttcctacatggacgctt
caaagacgcatgctcatgaatggaacatcaatggcatctccttctgcctgtggagcaatt
gcgttacttctaagtgctatgaaggctgaaggcatcccagttagcccgtacactgtgaga
agggccctcgagaatacatctacacctgtaggtgatctgcctgaagataaactaactact
ggacaagggcttatgcaagtcgataaggcatatgaatacttgaaaaagtttcaggactgt
ccatgcgtaaactatcagataaaggtcaatctctccggaaaaacaattccaacatcacgg
ggcatttacctgcgggagggtactgcttgcagacagtctactgagtggacggtacaagtt
gatccgaagttccatgaaggtgcaagtaatttaaaggaacttgtcccttttgaggaatgt
cttgagttgcacaccacagatgaaggagttgtacgggttcctgactatctccttctcact
cataatggacgtagcttcaacgttgttgtggaccccacaaatcttgggtatggtgtgcat
tactttgaagtttatgggattgattgcaaagcaccagagcgtggtcctcttttcagaatt
ccagtaacaataataataccagagactgtggcaaatcgacctccagttatttcatttcca
caaatgtctttcatctcaggccacattgaacgaagatttatcgaggtaccacatggagca
acatgggctgaggctacaatgcgaacttcggggtttgatactacacgacgattttatatt
gatacacttcagctttgcccattgcgaaggcctatcaagtgggagagcgcatcaactttc
gcatctccatctgctaaaagctttacgtttcctgtgtttagtggtcaaacgatggaacta
gctatagctcaattctggtcaagtggccttgggagtcgtgaaccgactatcgttgacttt
gagattgcatttcatggaattggtgtcgataaagaagaactgttacttgatggaagtgaa
gcaccaataaaagttgaagctgaagctctgttggcatctgaaaaactcgttcccatagct
gttctgaacaagattcgagttccgtatcaaccaattgatgcacaactgaagactttatca
actagccgtgataggctactgtccggcaaacaaatactagcattgacattaacctacaag
ttcaaattagaagatgcagctgaagtgaaaccgtatataccattattgaacaatcgcata
tacgacacaaaatttgagtcccagttttatatgatctctgatgccaataagcgtgtatat
gcaacgggtgatgtttatcctgaatcttctaaacttccgaagggagaatataaacttcag
ctgtatctgaggcatgaaaatgtgcagctgctggaaaagttgaagcagctcattttgttt
atcgaaagaaatgtgggggaggttcggctgaacttacattctgaaccagatggtccagtc
acagggaatggtgcctttaagtcctctcttctaatgccagggtacttttttttttggctc
acttaccagtttaaacttaactctccccaaggatctgtgttggtgggagaaatctcatat
gggaaactgtcgtttgatgataaagaagggaagaatccaaaggataatcctgtatcttat
ccgatatcatatgtggttccaccaaataagcctgatgaagataaaaaggcatcttctgct
tcaaattgctctaaatcagtatcagaacgcttggaacaagaggttcgtgacacaaagatt
aaatttctcgggagcctgaaacaagaaaccgaggaagagcgttcagagtggagaaagttg
tgtgcctgtctcaagtctgaatacccaaattatactccattactagctaagatcctggaa
ggtttgctctctcggtctgatgctggggacaaaatcagccatcacgaagagattatagaa
gctgcaaacgaagtagtacgcagtgttgacgaagatgagttagcaagattcttgcaacaa
aaaagtgaaccagaagatgaggaagcagagattttgaagaaaaaaatggaaatgacacgt
gatcaactgacagaggcactataccagaaagggttagccatggcaagaattgagaatttg
aagggtgagaagggagatgaaggagaagaagaaagtagccagaaggataaattcgaggag
aatttcaaagaactgacaaaatgggtagacgtgaaatcatcgaagtttggcactctcact
gttctaagagagaaacggctctcacgactcgggaccgcgttgaaggtacttgatgacttg
atccaaaacgagagcgagattgcgaataagaaactctacgaactgaaactgggtctgctg
gaggaactaggttggagccatttggtaacatatgagaagcaatggatgcaggttcgtttc
cctacaagtttacccctcttttag

DBGET integrated database retrieval system