KEGG   Camelina sativa (false flax): 104724244Help
Entry
104724244         CDS       T05044                                 

Definition
(RefSeq) cysteine--tRNA ligase 2, cytoplasmic
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:csat00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    104724244
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csat01007]
    104724244
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:csat03016]
    104724244
Enzymes [BR:csat01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     104724244
Amino acid related enzymes [BR:csat01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   104724244
Transfer RNA biogenesis [BR:csat03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    104724244
 Prokaryotic type
    104724244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1f Rapsyn_N tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 104724244
NCBI-ProteinID: XP_010441011
Position
11
AA seq 511 aa AA seqDB search
MEAEKMELKLYNTMTQQKEVLIPITPGKIGLYVCGITAYDFSHIGHARAAVSFDVLYRYL
KHLGYEVNFVRNFTDVDDKIINRANERGIEPLALSNQFCEEYLVDMGALQCLLPTHQPRV
SDHMDHIIKMIEKIIEKDCGYVVEGDVFFSVDKSPNYGKLSGQMLEHTRAGERVAVDSRK
RNPADFALWKAAKPDEPSWESPWGPGRPGWHIECSAMSAHYLSPKFDIHGGGADLKFPHH
ENEIAQTCAACEDSGVNYWMHNGHVTINNEKMAKSKKNFKTIREMTDSYHPLALRHFLMS
AQYRSPLNFSKSQLEHASEALYYVYQTLQDLDEGLTPYRELMSEDGGKAEQTPEAKDIIK
KLKGEFEAKMLDDLNTAHILTGAYQDALKFINASLSKLKKMQKKQRLSMLVSLVEIEKAA
REVLDVLGLLTTLTYAEVLKEMKLKTLIRAELGEEDISQLIEERITARKNKDFEKSDQIR
EELTRKGIALMDIGKETVWRPCFPSQADSSN
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggagaaaatggaattgaagctctacaacacgatgacgcagcagaaggaagtg
ttgattccgatcactcccggcaaaatcggattgtacgtctgtggtatcactgcttacgat
ttcagccatatcggacatgcacgcgccgccgtttcctttgatgttctttacagatacttg
aagcatttgggttatgaagttaattttgtacgcaatttcacagatgttgatgacaagatc
atcaatcgtgctaatgagcgtggtatagaaccgttagcattaagtaatcagttttgcgag
gaatatttggtagatatgggtgctcttcagtgcctccttcccacccaccagcctcgtgta
agcgaccatatggaccacataataaagatgattgaaaagatcattgagaaagattgtggg
tatgtagtggaaggcgatgtgttcttttcggttgacaaatcacccaactatgggaaatta
tctgggcaaatgttggaacatacaagagctggtgagcgtgttgctgttgactcgagaaag
cgtaaccctgctgattttgcactatggaaggctgcaaaacctgatgagccaagttgggag
agcccttggggtcctggaagaccaggatggcacatcgagtgcagtgcaatgagtgctcat
tatctgtctccgaaatttgacattcatggaggtggtgcagatctgaaattcccgcatcat
gaaaatgagattgcccagacatgtgctgcatgtgaagatagtggtgtaaactactggatg
cacaatgggcatgtcactattaataacgagaagatggcaaaatcaaagaaaaactttaaa
acgattagagaaatgacagatagctaccatccgttggctttgcggcacttcttgatgagt
gcacagtaccggtctcctctgaacttctcaaagtcacagctagagcatgcatcagaagct
ttatactatgtttaccagactttacaagatcttgatgaaggtctgacaccatatcgagaa
ttaatgtctgaagatggtggaaaggctgaacagactccagaagccaaagacatcattaag
aagctgaagggtgaattcgaagcaaagatgttagacgatttgaataccgctcatatactt
acgggtgcttaccaagatgcattgaaattcatcaacgcatcactcagcaagctcaagaaa
atgcagaagaaacagcgactgtcgatgcttgtgtcactcgtcgagattgagaaagcagca
agggaagttcttgatgtacttggtttgctcactactctgacctacgccgaggtgttgaaa
gaaatgaaactaaaaacactgataagagcagagttgggagaagaagatatttcacagtta
atagaagaaaggataacggcacgaaagaataaagattttgagaaaagtgatcagattagg
gaggaactgacaagaaaaggtatagcattaatggatattggcaaagaaactgtgtggagg
ccatgcttcccttctcaggctgattccagcaattga

DBGET integrated database retrieval system