KEGG   Camelina sativa (false flax): 104725048Help
Entry
104725048         CDS       T05044                                 

Definition
(RefSeq) glutathione gamma-glutamylcysteinyltransferase 1
  KO
K05941  glutathione gamma-glutamylcysteinyltransferase [EC:2.3.2.15]
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    104725048
Enzymes [BR:csat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.15  glutathione gamma-glutamylcysteinyltransferase
     104725048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phytochelatin_C Phytochelatin
Motif
Other DBs
NCBI-GeneID: 104725048
NCBI-ProteinID: XP_010441944
Position
11
AA seq 485 aa AA seqDB search
MAMASLYRRSLPSPPAIDFSSAEGKLIFNEALQKGTMEGFFRLISYFQTQSEPAYCGLAS
LAVVLNALSIDPGRKWKGPWRWFDESMLDCCEPLEVVKEKGISFGKVVCLAHCSGAKVEA
FRTSQSSIDEFRELVEKCTRSENCHMISTYHRGVFKQTGSGHFSPIGGYNAERDMALILD
TARFKYPPHWVPLELLWEAMDSIDKSTGKHRGFMLISRPHREPGLLYTLSCKDESWIDTA
KYLKEDVPRLVSSQDVDSVEKIISVVFKSLPSNFNQFIRWVAEIRITEDSNKHLSAEEKS
RLNLKELVLKEVHETELFKHINKFLSSVCYEDSLTYTAAMACCQGAEILSGCSSKKFCCR
ETCVKIKGPGDDEGTVVTGVVVRDGNEQKVDLLVPSTKTDCECGPEANYPAGNDVFTALL
LALPPQTWSGIKDQALMEEMKQLISVASLPTLLQEEVLHLRRQLQLLKRCQENKEEDDLA
APACA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggctatggcgagtttatatcggagatctcttccttctcctccggctattgacttttct
tccgccgaaggcaagctaatcttcaatgaagcgctacagaaaggaaccatggaaggattt
ttcaggttgatttcttatttccagacacagtctgaacctgcgtactgtggtttggctagc
cttgcagtcgtgttgaatgctctttctattgatcctggtcgtaaatggaaagggccttgg
aggtggtttgatgaatcaatgcttgactgctgcgagccacttgaagtagttaaggaaaag
ggtatctcgtttgggaaagttgtctgtttggctcattgttctggagctaaagttgaggct
ttccgaacgagtcagagcagcattgacgaattccgtgaattggtcgagaaatgcactcgt
tctgagaactgtcatatgatctcaacgtatcacagaggcgtgtttaagcagactgggtct
ggtcacttttcacctattggtggctataatgctgagagagatatggctttgattcttgat
accgctcgtttcaagtatcctcctcactgggttcctcttgaacttctttgggaagctatg
gacagcattgataagtctacagggaaacacagagggttcatgctcatatctagacctcac
agagaacctggattactatatactctgagctgcaaggatgaaagctggatcgacacagcc
aagtatttgaaggaagatgttcctcgtcttgtaagttcacaggatgtagattctgtggaa
aaaatcatatcagttgtgttcaagtctcttccatccaatttcaaccaattcatcagatgg
gtggctgagatccgaattacagaggactccaacaaacatctcagcgcagaggagaaatcg
aggttgaaccttaaggaattggtgctgaaagaagttcacgaaactgaactgttcaaacac
atcaataagttcttatcctcagtgtgttatgaagacagtctgacatatactgctgcaatg
gcctgttgccaaggagctgaaatcttatccggatgctcatcaaagaagttctgttgtcgg
gaaacttgtgtgaagatcaaaggtcctggtgatgatgaaggcacggtggtgacaggagtt
gtggtgcgtgacgggaatgaacaaaaggtagatctactggtgccatcaaccaaaactgac
tgtgaatgtggtccggaagcaaattatccagcaggaaacgatgtgttcactgcacttctg
ttggctttacctccacagacatggtcagggatcaaagaccaagctctgatggaagagatg
aagcagctcatttccgtggcttccctcccaactctgcttcaagaagaggtattgcatctt
cgacggcaacttcagctgctaaaacgatgccaagagaacaaggaagaggatgatctcgct
gctcctgcctgtgcctag

DBGET integrated database retrieval system