KEGG   Camelina sativa (false flax): 104725493Help
Entry
104725493         CDS       T05044                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase-like isoform X1
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00511  Other glycan degradation
csat00600  Sphingolipid metabolism
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    104725493
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    104725493
Enzymes [BR:csat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     104725493
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N EF-hand_5
Motif
Other DBs
NCBI-GeneID: 104725493
NCBI-ProteinID: XP_010442464
Position
11
AA seq 956 aa AA seqDB search
MSDVKIMDSGEDVKSFNSSDTKVDPAVPASLTWQRKIDSDVKAPREFNLTPKEIFQLAPV
GIRLWFLVREEAAKGRLAFIDPFSKHSVTSSHGVPLGGIGAGSIGRSFKGEFQRWQLFPP
RCEDEPVLANQFSAFVSRANGKKNYSSVLCPKNPKLGKQESESGIGSWDWNLKGDKSTYH
ALYPRSWTMYEGEPDPELRIVCRQVSPFIPHNYKESSFPVSVFTFTLHNLGDTTADATLL
FTWANSVGGDSEFSGGHYNSKIMMNDGVQGVLLHHKTAIGLPSLSYAISAQSTDGVSVST
CPFFIVSGKQNGITAKDMWQVIKENGSFDNFEASEVSMPSEHGSSIGAAVAASATVPPGE
SRIVTFSLAWDCPEVQFPSGKIYSRRYSKFYGNHGDAAAQIAYDAILGHSQWESWIEAWQ
RPILEDKRLPEWYPITLFNELYYLNSGGTVWTDGSSPVHSLAGVREKKFSLDKSQLGLKN
DTTDVPRQNDTAISVLEKMSSTLEELHASTASNSAFGTKLLEEGEENIGHFLYLEGVEYR
MWNTYDVHFYSSFALVMLFPKLELSIQRDFAAAVMLHDPTKVKTLTEGQWVQRKVLGAVP
HDLGINDPWFEVNGYNLHNTDRWKDLNPKFVLQVYRDMVATGDKKFATAVWPSVYVAMAY
MAQFDKDGDGMIENEGFPDQTYDTWSASGVSAYSGGLWVAALQAASALARVVDDKNSQDY
FWKKFQKAKVVYEKQLWNGSYFNYDNSGSPYSSSIQADQLAGQWYARASGLLPIVDEDKA
RTALEKVYNFNVMKIKDGKRGAVNGMHPSGKVDTASMQSREIWSGVTYALSATMIQEGLV
DMAFQTASGVYEAAWSEGGLGYSFQTPEAWNTNDEYRSLTYMRPLAIWAMQWALTKTSKE
QQQLGLEPEQEPEPNSLMKHDIGFSRVSRLLNLPNEASPKSTLQTLFDYTCRRIMS
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgtaaagatcatggatagtggtgaagatgtcaaatctttcaactcttctgat
actaaagttgatccggcggtacctgcatctttgacatggcaaagaaagatagatagtgac
gtaaaggctcctcgggaattcaatctaactcctaaagagatttttcagctggctcctgtt
ggcattcggttatggtttcttgtcagagaagaagctgctaaaggaaggttggctttcata
gatccattctctaagcactctgtaacgtcttcccatggtgttccacttggaggtattggt
gctggaagcataggaaggagttttaaaggtgaattccagagatggcaactattccctcca
agatgtgaagatgaaccagttctagcaaatcagttctcagcatttgtttcacgtgctaat
ggtaaaaaaaattactcaagcgtgttatgtcctaagaacccaaagcttggcaaacaagag
tcagaatctggaattggttcttgggactggaatctgaaaggagacaagtctacctatcat
gctttatacccaaggtcctggacaatgtatgagggtgaacctgatccagagcttaggatt
gtatgtcgtcaagtttcaccttttatacctcacaactacaaagaaagcagctttcctgtg
tctgttttcactttcacacttcataatctcggagacactactgcggatgcgacattgctc
ttcacttgggcgaattctgttggaggagattcagagttctcaggtggccactacaactcc
aagataatgatgaatgatggagtccagggtgtgcttttacaccataaaacagcaatcgga
ttaccatcactgtcatatgcgatttcggctcagtccaccgatggtgttagtgtgtcaacc
tgcccatttttcatagtatctggaaaacagaatggaatcacagcaaaagatatgtggcaa
gttattaaagagaatggttcttttgataactttgaggcttctgaggtgtcgatgccgtcg
gagcacgggtcatcgattggggcagcagtagcagcctctgcaacagtcccaccgggagag
tcacgcattgtcacattttctctggcttgggactgccctgaagtgcagtttccaagtggt
aaaatatattctcggcgttactcaaagttttacggaaatcatggtgatgctgcagcacaa
attgcatatgatgctattcttggacatagtcaatgggagtcctggatagaagcatggcaa
agaccaatacttgaagacaaaaggctgcctgaatggtaccctatcactctattcaacgag
ctttattaccttaattcaggaggaactgtttggacagatggatcatccccagtacatagc
ttggcaggagtcagagaaaagaagttctcacttgataagtcccaactcggtctaaagaac
gatactactgatgtaccgcggcagaatgatacagctatctctgtccttgagaaaatgtca
tctacacttgaggaacttcatgcatcaacagcatcaaactctgcatttggcactaaacta
ctggaagaaggagaagagaacattgggcacttcctttacctagaaggggttgaatatcgt
atgtggaacacctatgatgttcatttctattcatcttttgcactagtgatgctgtttcca
aaactggaacttagtatccagagagactttgctgctgcggtgatgctacacgatcccact
aaagttaaaactcttactgagggacaatgggttcagaggaaggttcttggtgcagttcct
catgacttaggcatcaatgacccttggtttgaagtcaatggttataaccttcacaataca
gatcggtggaaagatttgaaccccaagttcgtcctccaagtgtaccgggatatggttgct
acaggtgacaagaagtttgcaacagctgtctggccctcagtgtatgttgcaatggcatat
atggctcagtttgacaaagatggcgatggaatgattgagaacgaaggatttccagatcag
acttacgatacatggtccgcgtctggtgtaagcgcatactctggtggactttgggtggct
gcactgcaagctgcatcagcattggcacgcgtagttgatgacaagaactctcaggactat
ttctggaaaaagtttcagaaagcaaaagttgtatatgagaaacagttgtggaatggttca
tattttaactatgacaatagtggaagtccgtatagctcatctatccaagctgatcaacta
gctggtcaatggtacgcgagagcatcaggccttttgcctattgtagatgaagacaaggca
agaacagctttggagaaagtttacaacttcaatgtgatgaagattaaagatgggaaacgt
ggggctgtaaacggtatgcatcccagtgggaaagttgatacagcgtctatgcaatcacga
gagatatggtccggtgttacatatgctctttctgctacaatgatccaagaaggtctagtt
gatatggcgtttcagactgcaagtggcgtttatgaagctgcttggtctgaaggcggactt
ggttactcgtttcagacgcctgaagcttggaacacgaatgatgagtatagatcactgact
tacatgcgtccccttgcaatatgggctatgcaatgggcactaacaaaaacaagtaaagaa
cagcaacaacttggtcttgaaccagaacaagaaccagagcctaactctttaatgaaacat
gatatcggtttctctcgggtttctaggcttctgaatctacctaatgaagcatctcccaaa
agcacactccagactttgttcgactatacttgccggagaattatgtcttag

DBGET integrated database retrieval system