KEGG   Camelina sativa (false flax): 104726040Help
Entry
104726040         CDS       T05044                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 1, mitochondrial
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00020  Citrate cycle (TCA cycle)
csat00310  Lysine degradation
csat00380  Tryptophan metabolism
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104726040
  09105 Amino acid metabolism
   00310 Lysine degradation
    104726040
   00380 Tryptophan metabolism
    104726040
Enzymes [BR:csat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     104726040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-GeneID: 104726040
NCBI-ProteinID: XP_010443109
Position
11
AA seq 460 aa AA seqDB search
MMLRAVIRRASTRGSSVSGLGKSLQSSRVAASAQSFHSVSATQVFCGNHASSFHHRSCPG
CSECSRTIFSGYQGTPLQRWVRPFSSDSGDVVEAVVPHMGESITDGTLATFLKKPGDRVE
ADEAIAQIETDKVTIDIASPASGVIQEFLVKEGDTVEPGNKVAIISTSADAVSHVAPSEK
IPEKPAPKPSTPAEKPKVETTKVAEKPKAPSPPPPPKQSAKEPQLPPKDRERRVPMTRLR
KRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSQYKDAFFEKHGVKLGLMSGFIKAAVSA
LQHQPVVNAVIDGDDIIYRDYVDISIAVGTSKGLVVPVIRGADKMNFADIEKTINGLAKK
ANEGTISIDEMAGGSFTVSNGGVYGSLISTPIINPPQSAILGMHSIVQRPMVVGGSVVPR
PMMYVALTYDHRLIDGREAVYFLRRIKDVVEDPQRLLLDI
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgcgtgctgttattaggagagcttccactagaggctcttctgtttcgggattg
ggaaaatcgctgcaatcgtcacgtgttgcagcttctgctcaaagttttcattctgtttca
gctacacaggtattttgtggaaaccatgctagtagctttcatcaccgttcctgtccaggg
tgttcagagtgctcaaggactattttcagcgggtaccaaggcacacccctgcaaagatgg
gtcaggcccttctcatctgatagtggggatgtcgtggaagctgttgtgcctcacatgggt
gaatcaatcacagatggaaccctagccacttttctgaagaagcctggtgacagagtagag
gctgatgaggctattgcacaaattgaaactgacaaggttacaatagatattgctagccca
gcaagtggtgttatccaagagtttctagtcaaggaaggagatactgtagaaccgggaaac
aaagttgctataatttctacgtctgcggatgctgtgtctcatgttgcaccctcagaaaag
ataccagagaaacctgctcccaagccttctactcctgctgagaagcccaaagttgaaact
actaaagttgctgagaaacctaaggcaccatcaccgccaccgccaccaaaacagtcagcc
aaagaaccgcagcttcctcctaaggatagggaaagacgggttcctatgacaagacttcgc
aaacgagtagcaactaggttgaaagactctcaaaacactttcgctttgctgacaactttc
aatgaagttgatatgactaatctgatgaagctccgatctcaatacaaggatgcatttttt
gaaaagcatggagtgaagttgggtcttatgtctggtttcattaaagctgctgtcagtgcc
ctccagcatcaaccagtagtaaatgcagttatcgacggagatgacatcatttacagagac
tatgtggatatcagtatcgctgttggtacctctaagggtctcgtggttccagtcataaga
ggtgctgacaaaatgaactttgctgacatagagaaaacgataaacggtcttgctaagaag
gctaatgaaggaaccatatcaatcgacgagatggcaggaggatcgttcacagtatcaaat
ggtggtgtctatggaagtctcataagcactccaatcatcaaccctcctcagtctgctatt
cttggaatgcattcgattgtgcaacgtccaatggttgtgggaggaagcgtagtaccgagg
ccaatgatgtatgtcgcgctgacttacgaccacaggctaattgatggaagagaggctgtg
tatttcttgcgccgtatcaaggatgttgtggaagatccccagaggcttctcctcgacatt
tga

DBGET integrated database retrieval system